DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tollo and AT1G72950

DIOPT Version :10

Sequence 1:NP_524757.1 Gene:Tollo / 44497 FlyBaseID:FBgn0029114 Length:1346 Species:Drosophila melanogaster
Sequence 2:NP_177438.1 Gene:AT1G72950 / 843626 AraportID:AT1G72950 Length:379 Species:Arabidopsis thaliana


Alignment Length:75 Identity:19/75 - (25%)
Similarity:36/75 - (48%) Gaps:5/75 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly  1076 FDAFVSYSSKD--ELFVNEELAPMLEMGEHRYKLCLHQRDFPVGGYLPETIVQAIDSSRRTIMVV 1138
            ||.|:|:...|  ..|::.....::......:|   ..::...|..:...:::||:.||..::||
plant    11 FDVFLSFRGLDTRRSFISFLYKELIRRNIRTFK---DDKELKNGRRITPELIRAIEGSRFAVVVV 72

  Fly  1139 SENFIKSEWC 1148
            |.|:..|.||
plant    73 SVNYAASRWC 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TolloNP_524757.1 LRR 54..400 CDD:443914
leucine-rich repeat 100..123 CDD:275380
leucine-rich repeat 124..144 CDD:275380
leucine-rich repeat 154..177 CDD:275380
leucine-rich repeat 178..201 CDD:275380
leucine-rich repeat 212..235 CDD:275380
leucine-rich repeat 236..259 CDD:275380
LRR 239..634 CDD:443914
leucine-rich repeat 260..283 CDD:275380
leucine-rich repeat 284..307 CDD:275380
leucine-rich repeat 308..333 CDD:275380
leucine-rich repeat 334..357 CDD:275380
leucine-rich repeat 358..381 CDD:275380
leucine-rich repeat 382..405 CDD:275380
leucine-rich repeat 406..429 CDD:275380
leucine-rich repeat 430..452 CDD:275380
leucine-rich repeat 453..500 CDD:275380
leucine-rich repeat 501..521 CDD:275380
leucine-rich repeat 525..547 CDD:275380
leucine-rich repeat 548..573 CDD:275380
leucine-rich repeat 604..640 CDD:275380
LRR_8 616..>660 CDD:404697
leucine-rich repeat 641..688 CDD:275380
leucine-rich repeat 689..816 CDD:275380
LRR <794..>920 CDD:443914
leucine-rich repeat 817..864 CDD:275380
leucine-rich repeat 865..888 CDD:275380
leucine-rich repeat 889..910 CDD:275380
TIR 1076..1211 CDD:214587 19/75 (25%)
AT1G72950NP_177438.1 PLN03210 2..>368 CDD:215633 19/75 (25%)
TIR 11..175 CDD:396246 19/75 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.