DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tollo and AT1G72890

DIOPT Version :10

Sequence 1:NP_524757.1 Gene:Tollo / 44497 FlyBaseID:FBgn0029114 Length:1346 Species:Drosophila melanogaster
Sequence 2:NP_001185387.1 Gene:AT1G72890 / 843620 AraportID:AT1G72890 Length:487 Species:Arabidopsis thaliana


Alignment Length:98 Identity:26/98 - (26%)
Similarity:46/98 - (46%) Gaps:9/98 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly  1076 FDAFVSYSSKD--ELFVNEELAPMLEMGEHRYKLCLHQRDFPVGGYLPETIVQAIDSSRRTIMVV 1138
            ||.|:|:..||  :.||:.....::..|...:|   ...:...|..:|..:.|||..||..::||
plant    39 FDVFLSFRGKDTRKNFVSFLYKALVSKGIRTFK---DDEELERGRPIPPELRQAIKGSRIAVVVV 100

  Fly  1139 SENFIKSEWCRFEFKSAHQSVLRDRRRRLIVIV 1171
            |..:..|.||..|.:    .:|:..:..|:.::
plant   101 SVTYPASSWCLEELR----EILKLEKLGLLTVI 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TolloNP_524757.1 LRR 54..400 CDD:443914
leucine-rich repeat 100..123 CDD:275380
leucine-rich repeat 124..144 CDD:275380
leucine-rich repeat 154..177 CDD:275380
leucine-rich repeat 178..201 CDD:275380
leucine-rich repeat 212..235 CDD:275380
leucine-rich repeat 236..259 CDD:275380
LRR 239..634 CDD:443914
leucine-rich repeat 260..283 CDD:275380
leucine-rich repeat 284..307 CDD:275380
leucine-rich repeat 308..333 CDD:275380
leucine-rich repeat 334..357 CDD:275380
leucine-rich repeat 358..381 CDD:275380
leucine-rich repeat 382..405 CDD:275380
leucine-rich repeat 406..429 CDD:275380
leucine-rich repeat 430..452 CDD:275380
leucine-rich repeat 453..500 CDD:275380
leucine-rich repeat 501..521 CDD:275380
leucine-rich repeat 525..547 CDD:275380
leucine-rich repeat 548..573 CDD:275380
leucine-rich repeat 604..640 CDD:275380
LRR_8 616..>660 CDD:404697
leucine-rich repeat 641..688 CDD:275380
leucine-rich repeat 689..816 CDD:275380
LRR <794..>920 CDD:443914
leucine-rich repeat 817..864 CDD:275380
leucine-rich repeat 865..888 CDD:275380
leucine-rich repeat 889..910 CDD:275380
TIR 1076..1211 CDD:214587 26/98 (27%)
AT1G72890NP_001185387.1 PLN03210 39..>413 CDD:215633 26/98 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.