DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tollo and HSL1

DIOPT Version :10

Sequence 1:NP_524757.1 Gene:Tollo / 44497 FlyBaseID:FBgn0029114 Length:1346 Species:Drosophila melanogaster
Sequence 2:NP_174166.1 Gene:HSL1 / 839742 AraportID:AT1G28440 Length:996 Species:Arabidopsis thaliana


Alignment Length:1051 Identity:214/1051 - (20%)
Similarity:338/1051 - (32%) Gaps:375/1051 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 SLNNIWLIPDGMVCPLKSLQHLNASYNKIQDISNFYFSASLSSRKARVCG----------STLQS 214
            |||.     ||.:     ||.:..|.    |..:.|.| |.:|..|..|.          |::.|
plant    15 SLNQ-----DGFI-----LQQVKLSL----DDPDSYLS-SWNSNDASPCRWSGVSCAGDFSSVTS 64

  Fly   215 LDLSANKMVSLPTAMLSALGRLTHLNMAKNSMSFLADRAFEGLLSLRVVDLSANRLTSLPPELFA 279
            :|||:..:.....:::..|..|.||::..||::...........||:.:|||.|.||...|:..|
plant    65 VDLSSANLAGPFPSVICRLSNLAHLSLYNNSINSTLPLNIAACKSLQTLDLSQNLLTGELPQTLA 129

  Fly   280 ETKQLQEIYLRNNSINVLAPGIFGELAELLVLDLASNELNSQWINAATFVG-LKRLMMLDLSANK 343
            :...|..:.|..|:.:...|..||:...|.||.|..|.|:.   ....|:| :..|.||:||.|.
plant   130 DIPTLVHLDLTGNNFSGDIPASFGKFENLEVLSLVYNLLDG---TIPPFLGNISTLKMLNLSYNP 191

  Fly   344 ISRLEAHIFRPLASLQILKLEDNYIDQLPGGI---FADLTNLHTLILSRNRISVIEQRTLQGLKN 405
            .|                          |..|   |.:||||..:.|:                 
plant   192 FS--------------------------PSRIPPEFGNLTNLEVMWLT----------------- 213

  Fly   406 LLVLSLDFNRISRMDQRSLVNCSQLQDLHLNDNKLQA-VPEALAHVQLLKTLDVGENMISQIE-- 467
                  :.:.:.::.. ||...|:|.||.|..|.|.. :|.:|.          |...:.|||  
plant   214 ------ECHLVGQIPD-SLGQLSKLVDLDLALNDLVGHIPPSLG----------GLTNVVQIELY 261

  Fly   468 NTSIT-----QLESLYGLRMTENSLTHIRRGVFDRMS--SLQILNLSQNKLKSIEAGSLQRNSQL 525
            |.|:|     :|.:|..||:.:.|:..:...:.|.:.  .|:.|||.:|.|:.....|:..:..|
plant   262 NNSLTGEIPPELGNLKSLRLLDASMNQLTGKIPDELCRVPLESLNLYENNLEGELPASIALSPNL 326

  Fly   526 QAIRLDGNQLKSIAGLFTELPNLVWLNISGNRLEKFDYSHIPIGLQWLDVRANRITQLGNYFEIE 590
            ..||:.||:|..      .||..:.||..               |:||||..|            
plant   327 YEIRIFGNRLTG------GLPKDLGLNSP---------------LRWLDVSEN------------ 358

  Fly   591 SELSLSTFDASYNLLTEITASSIPNSVEVLYLNDNQISKIQPYTFFKKPNLTRVDLVRNRLTTLE 655
                    :.|.:|..::.|.   ..:|.|.:..|..|.:.|.:.....:|||:.|..||.:...
plant   359 --------EFSGDLPADLCAK---GELEELLIIHNSFSGVIPESLADCRSLTRIRLAYNRFSGSV 412

  Fly   656 PNALRLSPIAEDREIPEFYIGHNAYECDCNLDWLQKVNRESRTQPQLMDLDQIHCRLAYARGSSH 720
            |...                            |                            |..|
plant   413 PTGF----------------------------W----------------------------GLPH 421

  Fly   721 VSLIEAKSDDFLCKYASHCFALCHCCDFQACDCKMECPDRCSCYHDQSWTSNVVDCSRASYEQTL 785
            |:|:|                                                            
plant   422 VNLLE------------------------------------------------------------ 426

  Fly   786 PSHIPMDSTQLYLDGNNFRELQSHAFIGRKRLKVLHLNHSRIEVLHNRTFYGLLELEVLQLQS-N 849
                        |..|:|....|.:..|...|.:|        :|.|..|.|.|..|:..|.: |
plant   427 ------------LVNNSFSGEISKSIGGASNLSLL--------ILSNNEFTGSLPEEIGSLDNLN 471

  Fly   850 QLKALNGNEFQGLDNLQELYLQHNAIATIDTLTFTHLYHLKILRLDHNAITSFAVWNFLPSY--L 912
            ||.| :||:|.|  :|.:..:....:.|:|.               |....|..:.:.:.|:  |
plant   472 QLSA-SGNKFSG--SLPDSLMSLGELGTLDL---------------HGNQFSGELTSGIKSWKKL 518

  Fly   913 NELRLASNPWTCSCEFIDKLRDYINRHEYVVDKLKMKCDVISGNSTQQMVIYPGSGEPASLPVVQ 977
            |||.||.|      ||..|:.|.|.... |::.|.:..::.||..            |.||..::
plant   519 NELNLADN------EFTGKIPDEIGSLS-VLNYLDLSGNMFSGKI------------PVSLQSLK 564

  Fly   978 CSQTLPLGLDNNFNYAEQAGG---ENASNATSTKMI---------------LNQPPKLDYIPILV 1024
            .:|.       |.:|...:|.   ..|.:......|               .|:..|..|:.:|.
plant   565 LNQL-------NLSYNRLSGDLPPSLAKDMYKNSFIGNPGLCGDIKGLCGSENEAKKRGYVWLLR 622

  Fly  1025 AILTAFIFVMICISLVFIFR---------QEMRVWCHSRFGVRLFYNAQKDVDKNEREKLFDAFV 1080
            :|......|::.....|.|:         .|...|....|. :|.::..:.::..:.:.:..|..
plant   623 SIFVLAAMVLLAGVAWFYFKYRTFKKARAMERSKWTLMSFH-KLGFSEHEILESLDEDNVIGAGA 686

  Fly  1081 SYSSKDELFVNEE--------LAPMLEMGEHRYKLCLHQRDFPVGGYLPETIVQAIDSSRRTIMV 1137
            |......:..|.|        ...:.|.|:     |     .|..||.|....:|.::...|:..
plant   687 SGKVYKVVLTNGETVAVKRLWTGSVKETGD-----C-----DPEKGYKPGVQDEAFEAEVETLGK 741

  Fly  1138 VSENFIKSEWC 1148
            :....|...||
plant   742 IRHKNIVKLWC 752

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TolloNP_524757.1 LRR 54..400 CDD:443914 65/253 (26%)
leucine-rich repeat 100..123 CDD:275380
leucine-rich repeat 124..144 CDD:275380
leucine-rich repeat 154..177 CDD:275380 5/16 (31%)
leucine-rich repeat 178..201 CDD:275380 7/22 (32%)
leucine-rich repeat 212..235 CDD:275380 5/22 (23%)
leucine-rich repeat 236..259 CDD:275380 5/22 (23%)
LRR 239..634 CDD:443914 97/408 (24%)
leucine-rich repeat 260..283 CDD:275380 9/22 (41%)
leucine-rich repeat 284..307 CDD:275380 6/22 (27%)
leucine-rich repeat 308..333 CDD:275380 8/25 (32%)
leucine-rich repeat 334..357 CDD:275380 7/22 (32%)
leucine-rich repeat 358..381 CDD:275380 4/25 (16%)
leucine-rich repeat 382..405 CDD:275380 2/22 (9%)
leucine-rich repeat 406..429 CDD:275380 2/22 (9%)
leucine-rich repeat 430..452 CDD:275380 8/22 (36%)
leucine-rich repeat 453..500 CDD:275380 13/55 (24%)
leucine-rich repeat 501..521 CDD:275380 7/19 (37%)
leucine-rich repeat 525..547 CDD:275380 7/21 (33%)
leucine-rich repeat 548..573 CDD:275380 3/24 (13%)
leucine-rich repeat 604..640 CDD:275380 7/35 (20%)
LRR_8 616..>660 CDD:404697 12/43 (28%)
leucine-rich repeat 641..688 CDD:275380 7/46 (15%)
leucine-rich repeat 689..816 CDD:275380 10/126 (8%)
LRR <794..>920 CDD:443914 34/128 (27%)
leucine-rich repeat 817..864 CDD:275380 17/47 (36%)
leucine-rich repeat 865..888 CDD:275380 3/22 (14%)
leucine-rich repeat 889..910 CDD:275380 2/20 (10%)
TIR 1076..1211 CDD:214587 16/81 (20%)
HSL1NP_174166.1 PLN00113 22..960 CDD:215061 209/1039 (20%)
leucine-rich repeat 62..85 CDD:275380 5/22 (23%)
leucine-rich repeat 86..109 CDD:275380 5/22 (23%)
leucine-rich repeat 110..133 CDD:275380 9/22 (41%)
leucine-rich repeat 134..157 CDD:275380 6/22 (27%)
leucine-rich repeat 158..181 CDD:275380 8/25 (32%)
leucine-rich repeat 182..206 CDD:275380 11/49 (22%)
leucine-rich repeat 207..230 CDD:275380 4/46 (9%)
leucine-rich repeat 231..254 CDD:275380 9/32 (28%)
leucine-rich repeat 255..278 CDD:275380 8/22 (36%)
leucine-rich repeat 279..300 CDD:275380 4/20 (20%)
leucine-rich repeat 302..325 CDD:275380 7/22 (32%)
leucine-rich repeat 326..344 CDD:275380 8/23 (35%)
leucine-rich repeat 350..370 CDD:275380 8/39 (21%)
leucine-rich repeat 374..397 CDD:275380 5/22 (23%)
leucine-rich repeat 398..421 CDD:275380 9/78 (12%)
leucine-rich repeat 422..445 CDD:275380 8/94 (9%)
leucine-rich repeat 446..469 CDD:275380 9/30 (30%)
leucine-rich repeat 470..493 CDD:275380 9/25 (36%)
leucine-rich repeat 494..517 CDD:275380 5/37 (14%)
leucine-rich repeat 518..541 CDD:275380 12/29 (41%)
leucine-rich repeat 542..564 CDD:275380 6/33 (18%)
leucine-rich repeat 565..584 CDD:275380 4/25 (16%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.