DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tollo and AT5G45220

DIOPT Version :9

Sequence 1:NP_524757.1 Gene:Tollo / 44497 FlyBaseID:FBgn0029114 Length:1346 Species:Drosophila melanogaster
Sequence 2:NP_199335.1 Gene:AT5G45220 / 834558 AraportID:AT5G45220 Length:546 Species:Arabidopsis thaliana


Alignment Length:442 Identity:96/442 - (21%)
Similarity:164/442 - (37%) Gaps:107/442 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 LSANKMVSLP---TAML----SALGRLTHLNMA---KNSMSFLADRAFEGLLSLRVVDLSANRLT 271
            ||::..|.||   |..:    |.:|.:.||.||   ||...|:   .|.|.:...|..|| ||:.
plant     4 LSSSSSVELPPQHTVFILYNGSRMGFIYHLIMALEKKNINVFV---GFNGCICEPVERLS-NRIE 64

  Fly   272 SLP-----PELFAETK----QLQEIYLRNNSINVLAPGIFGELAELLVLDLA------------S 315
            |:.     ...:.|:|    :|.:|.......:::|..||.:|....|..|:            |
plant    65 SIIVLVIFTSRYTESKWCLMKLVDINKCAEKDHLVAIPIFYKLDPSTVRGLSGQFGDAFRDLRES 129

  Fly   316 NELNSQWINAATFVGLKRLMMLDLSANKISRLEAHIFRPLASLQILKLEDNYIDQLPGGIFADLT 380
            ..|..:|..|...:..:..:.:|.|:.|..|:|..:.:.|:.:......:..:|        .|.
plant   130 TGLMEKWKEALKSISDRPGIRVDKSSPKAKRIEIVVKKVLSRIPSEGSHNASVD--------PLE 186

  Fly   381 NLHTLILS---RNRISVIEQRTLQGLKNLLVLSLDFNRISRMDQRSLVNCSQLQDLHLNDNKLQA 442
            |..|.:.|   .||...|::| |:..|:    .||.|:: |.....::.|            |..
plant   187 NSDTRLTSSGEENRTFGIKER-LKEFKD----KLDLNKM-RSQLGMVIGC------------LLV 233

  Fly   443 VPEALAHVQLLKTLDVGE----NMISQIENTS-----ITQLESLYGLRMTENSLTHIRRGVF--- 495
            :...|.......|..:||    ..||.|:..:     |.:.....|.....::.|....|.:   
plant   234 LFFVLKQSAYTSTRLIGEGGAIGAISAIDRIADNVPKIREYVPEEGTEKPRDTYTEFHTGKYGTK 298

  Fly   496 -DRMSSLQILNLSQNKLKSIEAGSLQRNSQLQAIRLDGNQLKSIAGLFTELPNL-VWLNISGNRL 558
             :|.||    ::..|      |..|.|.  ....|:||.         .:.|.. |::|..|::|
plant   299 PERSSS----DVKTN------ADLLDRT--FTDTRMDGK---------VKPPKFQVFINFRGDQL 342

  Fly   559 EKFDYSHIPIGLQ------WLDVRANRITQLGNYFE-IE-SELSLSTFDASY 602
            ......::...|:      ::|.:..|...|...|: || |.:::..|.:.|
plant   343 RNNFVGYLVDALRRSEINVFIDNQEQRGEDLNTLFKRIEDSGIAIVVFSSRY 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TolloNP_524757.1 LRR_RI <85..281 CDD:238064 23/78 (29%)
leucine-rich repeat 100..123 CDD:275380
leucine-rich repeat 124..144 CDD:275380
LRR_8 152..222 CDD:290566 2/4 (50%)
leucine-rich repeat 154..177 CDD:275380
leucine-rich repeat 178..201 CDD:275380
LRR 210..656 CDD:227223 96/442 (22%)
leucine-rich repeat 212..235 CDD:275380 7/24 (29%)
leucine-rich repeat 236..259 CDD:275380 9/25 (36%)
leucine-rich repeat 260..283 CDD:275380 8/31 (26%)
LRR_RI 276..558 CDD:238064 62/314 (20%)
leucine-rich repeat 284..307 CDD:275380 6/22 (27%)
leucine-rich repeat 308..333 CDD:275380 6/36 (17%)
leucine-rich repeat 334..357 CDD:275380 6/22 (27%)
leucine-rich repeat 358..381 CDD:275380 2/22 (9%)
leucine-rich repeat 382..405 CDD:275380 7/25 (28%)
leucine-rich repeat 406..429 CDD:275380 5/22 (23%)
leucine-rich repeat 430..452 CDD:275380 2/21 (10%)
leucine-rich repeat 453..500 CDD:275380 11/59 (19%)
leucine-rich repeat 501..521 CDD:275380 3/19 (16%)
leucine-rich repeat 525..547 CDD:275380 3/21 (14%)
leucine-rich repeat 548..573 CDD:275380 5/31 (16%)
leucine-rich repeat 604..640 CDD:275380
leucine-rich repeat 641..688 CDD:275380
leucine-rich repeat 689..816 CDD:275380
LRR_8 815..875 CDD:290566
leucine-rich repeat 817..864 CDD:275380
LRR_8 864..921 CDD:290566
leucine-rich repeat 865..888 CDD:275380
leucine-rich repeat 889..910 CDD:275380
TIR 1076..1211 CDD:214587
AT5G45220NP_199335.1 TIR 16..171 CDD:279864 38/158 (24%)
TIR 330..468 CDD:214587 14/65 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 44 1.000 Domainoid score I4673
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D282372at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.