DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tollo and AT5G40100

DIOPT Version :10

Sequence 1:NP_524757.1 Gene:Tollo / 44497 FlyBaseID:FBgn0029114 Length:1346 Species:Drosophila melanogaster
Sequence 2:NP_198826.1 Gene:AT5G40100 / 834007 AraportID:AT5G40100 Length:1017 Species:Arabidopsis thaliana


Alignment Length:538 Identity:119/538 - (22%)
Similarity:199/538 - (36%) Gaps:157/538 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 ELRDLTIEYCKLG---NLTDGSFRGLQELRNLTIRTHNGDWSTMSLEMASNSFVEFR-------- 152
            :...:::..|::.   ::..|.|..:.:||.|.:..|..:..:|...:..:.:....        
plant   519 QTESISLHICEMTCAFSMATGVFSRMYKLRFLKVYKHVNERESMLQVIPEDEYPSINCLLLHWDA 583

  Fly   153 -QLERLDLSLNNIWLIPDGMVCPLKSLQHLNASYNKIQDISNFYFSASLS---SRKARVCGS-TL 212
             .|.:..|..|...|:            .||..::.::.:    :|..|.   .||..|.|| .|
plant   584 FPLSKFPLRFNTYCLV------------ELNLRHSNLETL----WSGVLKFGHLRKLDVTGSKNL 632

  Fly   213 QSL-DLS------------ANKMVSLPTAML--SALGR--LTHLNMAKNSMSFLADRAFEGLLSL 260
            :.| |||            ..::..:|.::.  |.|||  |::...|||.|..:..:..:     
plant   633 KQLPDLSCAEELDELLLEQCKRLKGIPESIAERSTLGRLNLSYYGGAKNPMGVVIQKVSQ----- 692

  Fly   261 RVVDLSANRLTSLPPELFAETKQLQEIYLRNNSINVLAPGIFGELAELLVLDLA--------SNE 317
                  ..|:|.|.|     |..: |:.|.|.||.       |::...:..|..        |.|
plant   693 ------TQRITLLFP-----TSSV-EMQLMNISIT-------GDIRFRVFADFEGYAEYFSFSTE 738

  Fly   318 LNSQWINAATFVGLKRLMMLDLSANKISRLE--------------AHIFRPLASLQILKLEDNYI 368
               |.|:|...|.:.:...|....||.:.|.              .|.|..:..|:.|:|.:..|
plant   739 ---QKIHATRTVSVHQAPRLISELNKSTTLNIRRFSYKENGRPVTLHSFPDIPGLKQLELVNLNI 800

  Fly   369 DQLPGGI--FADLTNLHTLILSRNRISVIEQRTLQGLKNLLVLSLDFNRISRMDQRSLVNCSQLQ 431
            .:|..||  |..|.||.   ||.|....:.:              |.||:||:....|.|||:|:
plant   801 QKLSDGIGHFEFLENLD---LSGNDFENLPE--------------DMNRLSRLKTLCLRNCSKLK 848

  Fly   432 DLHLNDNKLQAVPEALAHVQLLKTLDVGENMISQIENTSITQLESLYGLRMTENSLTHIRRGVFD 496
            :|          || |..||.| ||...:|:.|.::.:..:|..|||.|                
plant   849 EL----------PE-LTQVQSL-TLSNCKNLRSLVKISDASQDPSLYSL---------------- 885

  Fly   497 RMSSLQILNLSQNKLKSIEAGS--LQRNSQLQAIRLDGNQLKSIAGLFTELPNLVWLNISGNRLE 559
                   |.|..:..|::::.|  |....:|..:.|..:..|.:.....:|.:||.|.:  |..:
plant   886 -------LELCLDNCKNVKSLSDQLSHFPKLAYLDLSSHDFKKLPSSIRDLTSLVTLCL--NNCK 941

  Fly   560 KF-DYSHIPIGLQWLDVR 576
            |. ....:|:.||:||.:
plant   942 KLKSLEELPLSLQFLDAK 959

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TolloNP_524757.1 LRR 54..400 CDD:443914 74/357 (21%)
leucine-rich repeat 100..123 CDD:275380 3/25 (12%)
leucine-rich repeat 124..144 CDD:275380 5/19 (26%)
leucine-rich repeat 154..177 CDD:275380 4/22 (18%)
leucine-rich repeat 178..201 CDD:275380 3/22 (14%)
leucine-rich repeat 212..235 CDD:275380 8/37 (22%)
leucine-rich repeat 236..259 CDD:275380 5/22 (23%)
LRR 239..634 CDD:443914 87/365 (24%)
leucine-rich repeat 260..283 CDD:275380 5/22 (23%)
leucine-rich repeat 284..307 CDD:275380 6/22 (27%)
leucine-rich repeat 308..333 CDD:275380 7/32 (22%)
leucine-rich repeat 334..357 CDD:275380 6/36 (17%)
leucine-rich repeat 358..381 CDD:275380 9/24 (38%)
leucine-rich repeat 382..405 CDD:275380 4/22 (18%)
leucine-rich repeat 406..429 CDD:275380 8/22 (36%)
leucine-rich repeat 430..452 CDD:275380 6/21 (29%)
leucine-rich repeat 453..500 CDD:275380 10/46 (22%)
leucine-rich repeat 501..521 CDD:275380 5/21 (24%)
leucine-rich repeat 525..547 CDD:275380 4/21 (19%)
leucine-rich repeat 548..573 CDD:275380 8/25 (32%)
leucine-rich repeat 604..640 CDD:275380
LRR_8 616..>660 CDD:404697
leucine-rich repeat 641..688 CDD:275380
leucine-rich repeat 689..816 CDD:275380
LRR <794..>920 CDD:443914
leucine-rich repeat 817..864 CDD:275380
leucine-rich repeat 865..888 CDD:275380
leucine-rich repeat 889..910 CDD:275380
TIR 1076..1211 CDD:214587
AT5G40100NP_198826.1 PLN03210 12..>943 CDD:215633 113/520 (22%)
leucine-rich repeat 790..812 CDD:275380 8/21 (38%)
leucine-rich repeat 813..835 CDD:275380 9/38 (24%)
leucine-rich repeat 856..884 CDD:275380 10/28 (36%)
leucine-rich repeat 885..908 CDD:275380 6/45 (13%)
leucine-rich repeat 909..931 CDD:275380 4/21 (19%)
leucine-rich repeat 953..972 CDD:275381 4/7 (57%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.