DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tollo and BAM3

DIOPT Version :10

Sequence 1:NP_524757.1 Gene:Tollo / 44497 FlyBaseID:FBgn0029114 Length:1346 Species:Drosophila melanogaster
Sequence 2:NP_193760.1 Gene:BAM3 / 827774 AraportID:AT4G20270 Length:992 Species:Arabidopsis thaliana


Alignment Length:608 Identity:152/608 - (25%)
Similarity:240/608 - (39%) Gaps:145/608 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 MSLEMASNSFVEFRQ-LERLDLSLNNIWLIPD--------GMVCPLKSLQHLNASYNKIQDISNF 194
            :||...:|..:..:| .:..|.||:: |.||:        |:.|     .:||.|..:: |:||.
plant    29 LSLIRQANVLISLKQSFDSYDPSLDS-WNIPNFNSLCSWTGVSC-----DNLNQSITRL-DLSNL 86

  Fly   195 YFSASLSSRKARVCGSTLQSLDLSANKMV------------------------------------ 223
            ..|.::|...:|:..| |..||:|:|...                                    
plant    87 NISGTISPEISRLSPS-LVFLDISSNSFSGELPKEIYELSGLEVLNISSNVFEGELETRGFSQMT 150

  Fly   224 --------------SLPTAMLSALGRLTHLNMAKNSMSFLADRAFEGLLSLRVVDLSANRLTSLP 274
                          |||.: |:.|.||.||::..|.......|::...|||:.:.||.|.|....
plant   151 QLVTLDAYDNSFNGSLPLS-LTTLTRLEHLDLGGNYFDGEIPRSYGSFLSLKFLSLSGNDLRGRI 214

  Fly   275 PELFAETKQLQEIYL-RNNSINVLAPGIFGELAELLVLDLASNELNSQWINAATFVGLKRLMMLD 338
            |...|....|.::|| ..|......|..||.|..|:.||||:..|...  ..|....||.|.:|.
plant   215 PNELANITTLVQLYLGYYNDYRGGIPADFGRLINLVHLDLANCSLKGS--IPAELGNLKNLEVLF 277

  Fly   339 LSANKISRLEAHIFRPLASLQILKLEDNYIDQLPGGIFADLTNLHTLILSR---NRISVIEQRTL 400
            |..|:::.........:.||:.|.|.:|:::   |.|..:|:.|..|.|..   ||:.......:
plant   278 LQTNELTGSVPRELGNMTSLKTLDLSNNFLE---GEIPLELSGLQKLQLFNLFFNRLHGEIPEFV 339

  Fly   401 QGLKNLLVLSLDFNRISRMDQRSLVNCSQLQDLHLNDNKLQA-VPEALAHVQLLKTLDVGENMIS 464
            ..|.:|.:|.|..|..:......|.:...|.::.|:.|||.. :||:|...:.||.|.:..|.:.
plant   340 SELPDLQILKLWHNNFTGKIPSKLGSNGNLIEIDLSTNKLTGLIPESLCFGRRLKILILFNNFLF 404

  Fly   465 QIENTSITQLESLYGLRMTENSLT-HIRRGVF--------------------------DRMSSLQ 502
            ......:.|.|.|:..|:.:|.|| .:.:|:.                          .:.|||.
plant   405 GPLPEDLGQCEPLWRFRLGQNFLTSKLPKGLIYLPNLSLLELQNNFLTGEIPEEEAGNAQFSSLT 469

  Fly   503 ILNLSQNKLKSIEAGSLQRNSQLQAIRLDGNQLK-SIAGLFTELPNLVWLNISGNRLE-KF---- 561
            .:|||.|:|.....||::....||.:.|..|:|. .|.|....|.:|:.:::|.|... ||    
plant   470 QINLSNNRLSGPIPGSIRNLRSLQILLLGANRLSGQIPGEIGSLKSLLKIDMSRNNFSGKFPPEF 534

  Fly   562 ---------DYSH------IPIG------LQWLDVRANRITQLGNYFEIESEL----SLSTFDAS 601
                     |.||      ||:.      |.:|:|..|...|     .:.:||    ||::.|.|
plant   535 GDCMSLTYLDLSHNQISGQIPVQISQIRILNYLNVSWNSFNQ-----SLPNELGYMKSLTSADFS 594

  Fly   602 YNLLTEITASSIPNSVEVLYLND 624
            :|..    :.|:|.|.:..|.|:
plant   595 HNNF----SGSVPTSGQFSYFNN 613

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TolloNP_524757.1 LRR 54..400 CDD:443914 81/323 (25%)
leucine-rich repeat 100..123 CDD:275380
leucine-rich repeat 124..144 CDD:275380 2/4 (50%)
leucine-rich repeat 154..177 CDD:275380 8/30 (27%)
leucine-rich repeat 178..201 CDD:275380 7/22 (32%)
leucine-rich repeat 212..235 CDD:275380 10/72 (14%)
leucine-rich repeat 236..259 CDD:275380 5/22 (23%)
LRR 239..634 CDD:443914 117/449 (26%)
leucine-rich repeat 260..283 CDD:275380 7/22 (32%)
leucine-rich repeat 284..307 CDD:275380 8/23 (35%)
leucine-rich repeat 308..333 CDD:275380 8/24 (33%)
leucine-rich repeat 334..357 CDD:275380 4/22 (18%)
leucine-rich repeat 358..381 CDD:275380 7/22 (32%)
leucine-rich repeat 382..405 CDD:275380 6/25 (24%)
leucine-rich repeat 406..429 CDD:275380 5/22 (23%)
leucine-rich repeat 430..452 CDD:275380 8/22 (36%)
leucine-rich repeat 453..500 CDD:275380 12/73 (16%)
leucine-rich repeat 501..521 CDD:275380 8/19 (42%)
leucine-rich repeat 525..547 CDD:275380 8/22 (36%)
leucine-rich repeat 548..573 CDD:275380 11/50 (22%)
leucine-rich repeat 604..640 CDD:275380 5/21 (24%)
LRR_8 616..>660 CDD:404697 3/9 (33%)
leucine-rich repeat 641..688 CDD:275380
leucine-rich repeat 689..816 CDD:275380
LRR <794..>920 CDD:443914
leucine-rich repeat 817..864 CDD:275380
leucine-rich repeat 865..888 CDD:275380
leucine-rich repeat 889..910 CDD:275380
TIR 1076..1211 CDD:214587
BAM3NP_193760.1 PLN00113 37..986 CDD:215061 149/600 (25%)
leucine-rich repeat 79..102 CDD:275380 6/23 (26%)
leucine-rich repeat 103..126 CDD:275380 5/22 (23%)
leucine-rich repeat 127..151 CDD:275380 0/23 (0%)
leucine-rich repeat 152..175 CDD:275380 5/23 (22%)
leucine-rich repeat 176..199 CDD:275380 5/22 (23%)
leucine-rich repeat 200..223 CDD:275380 7/22 (32%)
leucine-rich repeat 224..248 CDD:275380 8/23 (35%)
leucine-rich repeat 249..272 CDD:275380 8/24 (33%)
leucine-rich repeat 273..296 CDD:275380 4/22 (18%)
leucine-rich repeat 297..318 CDD:275380 7/23 (30%)
leucine-rich repeat 321..344 CDD:275380 5/22 (23%)
leucine-rich repeat 345..368 CDD:275380 5/22 (23%)
leucine-rich repeat 369..392 CDD:275380 8/22 (36%)
leucine-rich repeat 393..414 CDD:275380 4/20 (20%)
leucine-rich repeat 441..467 CDD:275380 0/25 (0%)
leucine-rich repeat 468..491 CDD:275380 8/22 (36%)
leucine-rich repeat 492..513 CDD:275380 7/20 (35%)
leucine-rich repeat 564..587 CDD:275380 7/27 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.