DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tollo and AT4G09430

DIOPT Version :9

Sequence 1:NP_524757.1 Gene:Tollo / 44497 FlyBaseID:FBgn0029114 Length:1346 Species:Drosophila melanogaster
Sequence 2:NP_001319887.1 Gene:AT4G09430 / 826526 AraportID:AT4G09430 Length:555 Species:Arabidopsis thaliana


Alignment Length:175 Identity:36/175 - (20%)
Similarity:72/175 - (41%) Gaps:31/175 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  1063 AQKDVDKNEREKLFDAFVSYSSKD--ELFVNEELAPMLEMGEHRYKLCLHQRDFPVGGYLPETIV 1125
            |........|.|.:|.|:|:...|  ...|:.....::::|...:|   ..::...|..:.|.:|
plant     2 ASSSTSSPTRVKEYDVFLSFRGADTRNNIVSYLHKALVDVGIRTFK---DDKELEEGDIISEKLV 63

  Fly  1126 QAIDSSRRTIMVVSENFIKSEWCRFEFKSAHQSVLRDRRRRLIVIVLGEVPQKEL-------DPD 1183
            .||.:|...::|:||.::.|.||..|.:...:..::|  ..::|.:..:|...::       :..
plant    64 NAIQTSWFAVVVLSEKYVTSSWCLEELRHIMELSIQD--DIIVVPIFYKVEPSDVRYQKNSFEVK 126

  Fly  1184 LRLYLKTNTYLQWGDKLFWQKLRFALPDVSSSQRSNVAG---QSC 1225
            |:.|......|:|...|              :|..|::|   |:|
plant   127 LQHYRDPEKILKWKGAL--------------TQVGNMSGKHFQTC 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TolloNP_524757.1 LRR_RI <85..281 CDD:238064
leucine-rich repeat 100..123 CDD:275380
leucine-rich repeat 124..144 CDD:275380
LRR_8 152..222 CDD:290566
leucine-rich repeat 154..177 CDD:275380
leucine-rich repeat 178..201 CDD:275380
LRR 210..656 CDD:227223
leucine-rich repeat 212..235 CDD:275380
leucine-rich repeat 236..259 CDD:275380
leucine-rich repeat 260..283 CDD:275380
LRR_RI 276..558 CDD:238064
leucine-rich repeat 284..307 CDD:275380
leucine-rich repeat 308..333 CDD:275380
leucine-rich repeat 334..357 CDD:275380
leucine-rich repeat 358..381 CDD:275380
leucine-rich repeat 382..405 CDD:275380
leucine-rich repeat 406..429 CDD:275380
leucine-rich repeat 430..452 CDD:275380
leucine-rich repeat 453..500 CDD:275380
leucine-rich repeat 501..521 CDD:275380
leucine-rich repeat 525..547 CDD:275380
leucine-rich repeat 548..573 CDD:275380
leucine-rich repeat 604..640 CDD:275380
leucine-rich repeat 641..688 CDD:275380
leucine-rich repeat 689..816 CDD:275380
LRR_8 815..875 CDD:290566
leucine-rich repeat 817..864 CDD:275380
LRR_8 864..921 CDD:290566
leucine-rich repeat 865..888 CDD:275380
leucine-rich repeat 889..910 CDD:275380
TIR 1076..1211 CDD:214587 28/143 (20%)
AT4G09430NP_001319887.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 44 1.000 Domainoid score I4673
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D282372at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.