DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tollo and AT2G25790

DIOPT Version :10

Sequence 1:NP_524757.1 Gene:Tollo / 44497 FlyBaseID:FBgn0029114 Length:1346 Species:Drosophila melanogaster
Sequence 2:NP_180150.1 Gene:AT2G25790 / 817121 AraportID:AT2G25790 Length:960 Species:Arabidopsis thaliana


Alignment Length:41 Identity:15/41 - (36%)
Similarity:18/41 - (43%) Gaps:2/41 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 TVAT-EESPATTTEVTDRGLFDFLGKKEEEVKPQETTTLES 55
            |||| ||.|....|.||....|.: :.....:.|...||.|
plant   399 TVATLEERPFVIVESTDPATGDCI-RNTVPCRKQSNLTLSS 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TolloNP_524757.1 LRR 54..400 CDD:443914 1/2 (50%)
leucine-rich repeat 100..123 CDD:275380
leucine-rich repeat 124..144 CDD:275380
leucine-rich repeat 154..177 CDD:275380
leucine-rich repeat 178..201 CDD:275380
leucine-rich repeat 212..235 CDD:275380
leucine-rich repeat 236..259 CDD:275380
LRR 239..634 CDD:443914
leucine-rich repeat 260..283 CDD:275380
leucine-rich repeat 284..307 CDD:275380
leucine-rich repeat 308..333 CDD:275380
leucine-rich repeat 334..357 CDD:275380
leucine-rich repeat 358..381 CDD:275380
leucine-rich repeat 382..405 CDD:275380
leucine-rich repeat 406..429 CDD:275380
leucine-rich repeat 430..452 CDD:275380
leucine-rich repeat 453..500 CDD:275380
leucine-rich repeat 501..521 CDD:275380
leucine-rich repeat 525..547 CDD:275380
leucine-rich repeat 548..573 CDD:275380
leucine-rich repeat 604..640 CDD:275380
LRR_8 616..>660 CDD:404697
leucine-rich repeat 641..688 CDD:275380
leucine-rich repeat 689..816 CDD:275380
LRR <794..>920 CDD:443914
leucine-rich repeat 817..864 CDD:275380
leucine-rich repeat 865..888 CDD:275380
leucine-rich repeat 889..910 CDD:275380
TIR 1076..1211 CDD:214587
AT2G25790NP_180150.1 PLN00113 12..960 CDD:215061 15/41 (37%)
leucine-rich repeat 74..98 CDD:275380
leucine-rich repeat 99..124 CDD:275380
leucine-rich repeat 125..146 CDD:275380
leucine-rich repeat 147..170 CDD:275380
leucine-rich repeat 171..194 CDD:275380
leucine-rich repeat 195..218 CDD:275380
leucine-rich repeat 219..242 CDD:275380
leucine-rich repeat 243..266 CDD:275380
leucine-rich repeat 267..290 CDD:275380
leucine-rich repeat 291..314 CDD:275380
leucine-rich repeat 315..336 CDD:275380
leucine-rich repeat 339..362 CDD:275380
leucine-rich repeat 363..383 CDD:275380
leucine-rich repeat 387..405 CDD:275380 4/5 (80%)
leucine-rich repeat 411..434 CDD:275380 5/23 (22%)
leucine-rich repeat 435..479 CDD:275380 3/4 (75%)
leucine-rich repeat 480..498 CDD:275380
leucine-rich repeat 504..525 CDD:275380
leucine-rich repeat 528..551 CDD:275380
leucine-rich repeat 552..575 CDD:275380
leucine-rich repeat 576..596 CDD:275380
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.