DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tollo and AT2G03300

DIOPT Version :9

Sequence 1:NP_524757.1 Gene:Tollo / 44497 FlyBaseID:FBgn0029114 Length:1346 Species:Drosophila melanogaster
Sequence 2:NP_178429.1 Gene:AT2G03300 / 814859 AraportID:AT2G03300 Length:203 Species:Arabidopsis thaliana


Alignment Length:236 Identity:51/236 - (21%)
Similarity:88/236 - (37%) Gaps:69/236 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   546 PNLVWLNISGNRLEKFDYSHIPIGLQ------WLDVRANRITQLGNYF-EI-ESELSLSTFDASY 602
            |..|:||..|.:|.:...||:....:      ::|....|...|.|.| .| ||:::|:.|...|
plant     6 PTQVFLNYRGEQLRRSFVSHLIDAFERNEINFFVDKYEQRGKDLKNLFLRIQESKIALAIFSTRY 70

  Fly   603 NLLTEITASS--IPNSVEVLYLNDNQISKIQPYTFFKKPNLTRVDLVRNRLTTLEPNALRLSPIA 665
                  |.||  :...|::..|.|.:...:.| .|:|    .:|:.||.:......|...|:.::
plant    71 ------TESSWCMDELVKIKKLADKRKLHVIP-IFYK----VKVEDVRKQTGEFGDNFWTLAKVS 124

  Fly   666 EDREIPEFYIGHNAYECDCN------------LDWLQKVNRESRTQPQLMDLDQIHCRLAYARGS 718
            ...:|.::   ..|.||..|            .|::::|            :..:.|.:|     
plant   125 SGDQIKKW---KEALECIPNKMGLSLGDKSDEADFIKEV------------VKAVQCVVA----- 169

  Fly   719 SHVSLIEAKSDDFLCKYASHCFALCHCCDFQACDCKMECPD 759
             .:.|.|.::               |....:..|||.|.||
plant   170 -TIGLEEEEN---------------HFGKKKRKDCKCELPD 194

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
TolloNP_524757.1 LRR_RI <85..281 CDD:238064
leucine-rich repeat 100..123 CDD:275380
leucine-rich repeat 124..144 CDD:275380
LRR_8 152..222 CDD:290566
leucine-rich repeat 154..177 CDD:275380
leucine-rich repeat 178..201 CDD:275380
LRR 210..656 CDD:227223 31/119 (26%)
leucine-rich repeat 212..235 CDD:275380
leucine-rich repeat 236..259 CDD:275380
leucine-rich repeat 260..283 CDD:275380
LRR_RI 276..558 CDD:238064 5/11 (45%)
leucine-rich repeat 284..307 CDD:275380
leucine-rich repeat 308..333 CDD:275380
leucine-rich repeat 334..357 CDD:275380
leucine-rich repeat 358..381 CDD:275380
leucine-rich repeat 382..405 CDD:275380
leucine-rich repeat 406..429 CDD:275380
leucine-rich repeat 430..452 CDD:275380
leucine-rich repeat 453..500 CDD:275380
leucine-rich repeat 501..521 CDD:275380