DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tollo and LOC563710

DIOPT Version :9

Sequence 1:NP_524757.1 Gene:Tollo / 44497 FlyBaseID:FBgn0029114 Length:1346 Species:Drosophila melanogaster
Sequence 2:XP_692159.4 Gene:LOC563710 / 563710 -ID:- Length:635 Species:Danio rerio


Alignment Length:409 Identity:104/409 - (25%)
Similarity:163/409 - (39%) Gaps:88/409 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 LDLASNELNSQWINAATFVGLKRLMMLDLSANKISRLEAHIFRPLASLQILKLEDNYIDQLPGGI 375
            |.|..|.|.|  :.|..||||.:|:.|.|..|.|:.::|..|:.:..|:.|.|..|.|..|....
Zfish    63 LSLRYNSLAS--LKAGQFVGLNQLIWLYLDHNYIANVDARAFQGIRRLKELILSSNKITLLHNTT 125

  Fly   376 FADLTNLHTLILSRNRISVIEQRTLQGLKNLLVLSLDFNRISRMDQRSLVNCSQLQDLHLNDNKL 440
            |..:.||..|.||.|::..::....|||:.||                        .||:..|.|
Zfish   126 FHLVPNLRNLDLSYNKLQALQPGQFQGLRKLL------------------------SLHMRSNSL 166

  Fly   441 QAVPEAL-AHVQLLKTLDVGENMISQIENTSITQLESLYGLRMTENSLTHIRRGVFDRMSSLQIL 504
            :.:|..| ...:.|:.||:|.|.:..|...|::.|..|..|.:..|..:.|....|.|..:|:.|
Zfish   167 KNLPSRLFQDCRNLEFLDLGYNRLRSITRNSMSGLLKLTELHIEHNQFSKINFFNFPRFYNLRAL 231

  Fly   505 NLSQNKLKSIEAGSLQRNSQLQAIRLDGNQLKSI-AGLFTELPNLVWLNISGNRLEKFDYSHIPI 568
            .|..|:::::..|.....:.||.:.|.||.|:.| |.::..:|||..||:..|:|.......:. 
Zfish   232 YLQWNRIRTMSEGLTWMWTSLQKLDLSGNDLQEIDAEVYRAMPNLQTLNLDSNKLVNVSQEAVD- 295

  Fly   569 GLQWLDVRANRITQLGNYF------------------------------EIESELSLSTFDASYN 603
              .|..:.|  |:..||.:                              |::.|..|...||  |
Zfish   296 --AWTSLTA--ISLAGNMWDCGPVVCPLVAWMRTFRGNKEINMICASPKEVQGEKVLDAVDA--N 354

  Fly   604 LLTEITASSIPNSVEVLYLNDNQISKIQPYTFFKK-------PNLTRVDLVRNRLTTLE------ 655
            .:..| |.:.|:::.|         ...|:..|.:       |.|...|..|...|:||      
Zfish   355 GVCRI-APATPSTIFV---------PSTPFVAFSQTPASSLVPTLKSGDSRRVHGTSLEGSTSSV 409

  Fly   656 PNALRLSPIAEDREIPEFY 674
            |:...:.|..:|.|...|:
Zfish   410 PSQPDVPPQEQDFEPVSFH 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TolloNP_524757.1 LRR_RI <85..281 CDD:238064
leucine-rich repeat 100..123 CDD:275380
leucine-rich repeat 124..144 CDD:275380
LRR_8 152..222 CDD:290566
leucine-rich repeat 154..177 CDD:275380
leucine-rich repeat 178..201 CDD:275380
LRR 210..656 CDD:227223 99/389 (25%)
leucine-rich repeat 212..235 CDD:275380
leucine-rich repeat 236..259 CDD:275380
leucine-rich repeat 260..283 CDD:275380
LRR_RI 276..558 CDD:238064 74/248 (30%)
leucine-rich repeat 284..307 CDD:275380
leucine-rich repeat 308..333 CDD:275380 10/21 (48%)
leucine-rich repeat 334..357 CDD:275380 7/22 (32%)
leucine-rich repeat 358..381 CDD:275380 7/22 (32%)
leucine-rich repeat 382..405 CDD:275380 8/22 (36%)
leucine-rich repeat 406..429 CDD:275380 2/22 (9%)
leucine-rich repeat 430..452 CDD:275380 6/22 (27%)
leucine-rich repeat 453..500 CDD:275380 14/46 (30%)
leucine-rich repeat 501..521 CDD:275380 5/19 (26%)
leucine-rich repeat 525..547 CDD:275380 8/22 (36%)
leucine-rich repeat 548..573 CDD:275380 5/24 (21%)
leucine-rich repeat 604..640 CDD:275380 6/42 (14%)
leucine-rich repeat 641..688 CDD:275380 11/40 (28%)
leucine-rich repeat 689..816 CDD:275380
LRR_8 815..875 CDD:290566
leucine-rich repeat 817..864 CDD:275380
LRR_8 864..921 CDD:290566
leucine-rich repeat 865..888 CDD:275380
leucine-rich repeat 889..910 CDD:275380
TIR 1076..1211 CDD:214587
LOC563710XP_692159.4 leucine-rich repeat 60..83 CDD:275380 10/21 (48%)
LRR_RI <81..286 CDD:238064 65/228 (29%)
LRR_8 83..142 CDD:290566 20/58 (34%)
leucine-rich repeat 84..107 CDD:275380 7/22 (32%)
leucine-rich repeat 108..131 CDD:275380 7/22 (32%)
LRR_8 130..190 CDD:290566 22/83 (27%)
leucine-rich repeat 132..155 CDD:275380 8/22 (36%)
leucine-rich repeat 156..179 CDD:275380 8/46 (17%)
LRR_8 178..238 CDD:290566 18/59 (31%)
leucine-rich repeat 180..203 CDD:275380 8/22 (36%)
leucine-rich repeat 204..227 CDD:275380 6/22 (27%)
leucine-rich repeat 228..251 CDD:275380 5/22 (23%)
LRR_8 250..308 CDD:290566 18/62 (29%)
leucine-rich repeat 252..275 CDD:275380 8/22 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.