DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tollo and cDIP

DIOPT Version :10

Sequence 1:NP_524757.1 Gene:Tollo / 44497 FlyBaseID:FBgn0029114 Length:1346 Species:Drosophila melanogaster
Sequence 2:NP_650951.1 Gene:cDIP / 42512 FlyBaseID:FBgn0038865 Length:554 Species:Drosophila melanogaster


Alignment Length:476 Identity:117/476 - (24%)
Similarity:197/476 - (41%) Gaps:118/476 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 LTHLNMAKNSMSFLADRAFE-GLLSLRVVDLSANRLTSLPPELFAETKQLQEIYLRNNSINVLAP 299
            ::.|:|....:.|:....|. |...|.::.||.|.:..||.:.|.....|:.|:|..|.:..|..
  Fly   118 VSELDMRGCGIRFIYWENFSIGADKLVILLLSDNHIEVLPTKTFRGAGNLEFIFLNRNKLGKLQA 182

  Fly   300 GIFGELAELLVLDLASNELNSQWINAATFVGLKRLMMLDLSANKISRLEAHIFRPLASLQILKLE 364
            |.|..|.:|..|||..|.|.:  :.|..|.|||.|..:.|:.|:::.:|:.:|.....|..:.::
  Fly   183 GAFDNLLKLQYLDLTENRLEA--LAADVFAGLKSLRHVGLAGNQLTTIESDLFAHNPDLLSVAMQ 245

  Fly   365 DNYIDQLPGGIFADLTNLHTLILSRNRISVIEQRTLQGLKNLLVLSLDFNRISRMDQRSLVNCS- 428
            :|.:.::  |.:|        ..||.|...::...|.....|:||.|:.| .:.:..|   ||| 
  Fly   246 NNRLREV--GEYA--------FRSRGRHHQMQYVDLSNNPELVVLLLNIN-ATNLTAR---NCSL 296

  Fly   429 -------QLQDLHLNDNKLQAV----PEALAHVQLLKTLDVGENMISQIENTSITQLESLYGLRM 482
                   .:.::.|:||:::.:    .|||.|:.|              .|.|:.||.||     
  Fly   297 DRVNLYGSVTNVDLSDNRVRELYFPASEALEHLVL--------------RNNSLVQLASL----- 342

  Fly   483 TENSLTHIRRGVFDRMSSLQILNLSQN-KLKSIEAGSLQRNSQLQAIRLDGNQ---LKSIAGLFT 543
                         .|:..|:.|:::.| .|..:..|....:.::..:|..|..   |:::.|   
  Fly   343 -------------SRVPRLRHLDVADNPNLGQLPDGWRTPHLEMLVLRNTGQMELPLEALQG--- 391

  Fly   544 ELPNLVWLNISGNRLEKFDYSHIPI----------GLQW--------LDV--RANRITQL----- 583
             :.||..|:||||.|.:.|.|..|.          |..|        :||  |||.|...     
  Fly   392 -MQNLQKLDISGNNLTEIDPSAFPTLTQLTHFYIHGNNWNCFSLRNIMDVLIRANGIAYTVDNYD 455

  Fly   584 ----GNYF----------EIESELSLSTFDASYNL-LTEITASSIPNSVEVLYLNDNQISKIQPY 633
                |.||          |.|...|.|:.:.|.:: .:.||:||.|:.|:  .|.|...:.:|.:
  Fly   456 PDFPGEYFHGIACMYRLPEKEGVDSSSSSEISASVESSPITSSSDPSEVD--KLRDELKAVVQHF 518

  Fly   634 TFFKKPNLTRVDLVRNRLTTL 654
            .       ::.||:.::|..|
  Fly   519 D-------SKFDLIFSKLAQL 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TolloNP_524757.1 LRR 54..400 CDD:443914 43/164 (26%)
leucine-rich repeat 100..123 CDD:275380
leucine-rich repeat 124..144 CDD:275380
leucine-rich repeat 154..177 CDD:275380
leucine-rich repeat 178..201 CDD:275380
leucine-rich repeat 212..235 CDD:275380
leucine-rich repeat 236..259 CDD:275380 5/23 (22%)
LRR 239..634 CDD:443914 113/451 (25%)
leucine-rich repeat 260..283 CDD:275380 7/22 (32%)
leucine-rich repeat 284..307 CDD:275380 8/22 (36%)
leucine-rich repeat 308..333 CDD:275380 10/24 (42%)
leucine-rich repeat 334..357 CDD:275380 5/22 (23%)
leucine-rich repeat 358..381 CDD:275380 4/22 (18%)
leucine-rich repeat 382..405 CDD:275380 4/22 (18%)
leucine-rich repeat 406..429 CDD:275380 9/30 (30%)
leucine-rich repeat 430..452 CDD:275380 7/25 (28%)
leucine-rich repeat 453..500 CDD:275380 7/46 (15%)
leucine-rich repeat 501..521 CDD:275380 5/20 (25%)
leucine-rich repeat 525..547 CDD:275380 4/24 (17%)
leucine-rich repeat 548..573 CDD:275380 12/42 (29%)
leucine-rich repeat 604..640 CDD:275380 9/36 (25%)
LRR_8 616..>660 CDD:404697 8/39 (21%)
leucine-rich repeat 641..688 CDD:275380 4/14 (29%)
leucine-rich repeat 689..816 CDD:275380
LRR <794..>920 CDD:443914
leucine-rich repeat 817..864 CDD:275380
leucine-rich repeat 865..888 CDD:275380
leucine-rich repeat 889..910 CDD:275380
TIR 1076..1211 CDD:214587
cDIPNP_650951.1 LRR 107..>410 CDD:443914 85/343 (25%)
leucine-rich repeat 118..142 CDD:275380 5/23 (22%)
leucine-rich repeat 143..166 CDD:275380 7/22 (32%)
leucine-rich repeat 167..190 CDD:275380 8/22 (36%)
leucine-rich repeat 191..214 CDD:275380 10/24 (42%)
leucine-rich repeat 215..238 CDD:275380 5/22 (23%)
leucine-rich repeat 239..265 CDD:275380 7/35 (20%)
leucine-rich repeat 266..325 CDD:275380 13/62 (21%)
leucine-rich repeat 326..347 CDD:275380 10/52 (19%)
leucine-rich repeat 348..394 CDD:275380 9/49 (18%)
leucine-rich repeat 395..418 CDD:275380 10/22 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.