DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tollo and CG32055

DIOPT Version :9

Sequence 1:NP_524757.1 Gene:Tollo / 44497 FlyBaseID:FBgn0029114 Length:1346 Species:Drosophila melanogaster
Sequence 2:NP_729599.1 Gene:CG32055 / 39188 FlyBaseID:FBgn0052055 Length:534 Species:Drosophila melanogaster


Alignment Length:648 Identity:151/648 - (23%)
Similarity:260/648 - (40%) Gaps:162/648 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LYVLIATCVIPIFGAALSKTVLYQAPDECRWSGGGEHDITLVCHLRTINSELENTNFSVIQPQNT 72
            |.||....:..:||..|         .||...|.|.:    :|  |.|.| .|..|..|.:...:
  Fly     4 LQVLALLLLSGVFGKDL---------QECEDLGNGSY----LC--REIES-FEQLNRYVGKNWKS 52

  Fly    73 VRLRLECNDALFFQSSLSPDSFRSLVELRDLTIEYCKLGNLTDGSFRGLQELRNLTIRTHNGDWS 137
            |:                            :..|:..:....||...||..|..|.:....|   
  Fly    53 VK----------------------------VVNEHTGIERAEDGELPGLSTLLQLDLSESGG--- 86

  Fly   138 TMSLEMASNSFVEFRQLERLDLSLNNIWLIPDGMVCPLKSLQHLNASYNKIQDISNFYFSASLSS 202
               :.:......:|:.|::|:|:        ...:..|||.|..|.|     ::.||        
  Fly    87 ---VTLGEKGLQDFKALQKLNLT--------HAQLDELKSEQFPNPS-----EMINF-------- 127

  Fly   203 RKARVCGSTLQSLDLSANKMVSLPTAMLSALGRLTHLNMAKNSMSFLADRAFEGLLSLRVVDLSA 267
                         |:|.|.::::.|.::|..|.|.:.|.::|.::.:...||..:.:||.:||:.
  Fly   128 -------------DVSYNDILAITTKLMSGFGNLVYANFSENLIAVIEPNAFRHMKNLRFLDLTT 179

  Fly   268 NRLTSLPPELFAETKQLQEIYLRNNSINVLAPGIFGELAELLVLDLASNELNS-QWINAATFVGL 331
            |                   |..|.::        ||.|.|..|.:::|.|.. ||.:...   |
  Fly   180 N-------------------YQENITL--------GENANLRFLSISNNNLRDFQWCHLRV---L 214

  Fly   332 KRLMMLDLSANKISRLEAHIFRPLASLQILKLEDNYIDQLPGGIF---ADLTNLHTLILSRNRIS 393
            .:|..|.|.:|.:..|:..||..|.:|::|.:.:|.:.::...:|   .::..|..|..|.|.:.
  Fly   215 PKLEELHLHSNWLEHLDMGIFYALPNLRVLNVSNNNLFEIKRTLFMAPGEIAPLELLDYSSNIVK 279

  Fly   394 VIEQRTLQGLKNLLVLSLDFNRISRMDQRSLVNCSQLQDLHLNDNKLQAVP-EALAHVQLLKTLD 457
            |::......||.|..|:|..|:|:|:..|:.:..|.||.|||..||:..:| :..|::..|:.||
  Fly   280 VLDDSVFCRLKKLRTLNLWLNQINRIHPRAFLGLSSLQTLHLQGNKISILPDDVFANLTALEKLD 344

  Fly   458 VGENMISQIENTSITQLESLYGLRMTENSLTHIRRGVFDRMSSLQILNLSQNKLKSIEAGSLQRN 522
            :.:|.|.::            |||:....:  :|:.::        |:||.|.:..:...:|...
  Fly   345 LSKNNIQKL------------GLRVFGERI--LRKLIY--------LDLSNNYIADLHPLALSSM 387

  Fly   523 SQLQAIRLDGNQLKSI-AGLFTELPNLVWLNISGNRLEKFDYSHIPI--GLQWLDVRANRITQLG 584
            ..::.:||..|:|.|: ..:|..|..|..|.|:.||||:.|...:..  .|..|::..||:|.|.
  Fly   388 PFIKELRLRRNRLVSLDLRMFAPLRQLQLLTINENRLEEIDGEILDTLDRLNHLELNNNRLTFLP 452

  Fly   585 NYFEIESELSLSTFDASYN-----LLTEITASSIPNSVEVLYLNDNQISKIQP---YTFFKKP 639
            :....::.|.|.......|     .|.|||:          :||...:|..:|   |...:||
  Fly   453 DLKSSQNLLQLRNITLEGNPWQCLCLDEITS----------WLNGRHVSYARPSSAYFSGRKP 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TolloNP_524757.1 LRR_RI <85..281 CDD:238064 36/195 (18%)
leucine-rich repeat 100..123 CDD:275380 5/22 (23%)
leucine-rich repeat 124..144 CDD:275380 3/19 (16%)
LRR_8 152..222 CDD:290566 14/69 (20%)
leucine-rich repeat 154..177 CDD:275380 4/22 (18%)
leucine-rich repeat 178..201 CDD:275380 5/22 (23%)
LRR 210..656 CDD:227223 113/446 (25%)
leucine-rich repeat 212..235 CDD:275380 5/22 (23%)
leucine-rich repeat 236..259 CDD:275380 5/22 (23%)
leucine-rich repeat 260..283 CDD:275380 5/22 (23%)
LRR_RI 276..558 CDD:238064 73/287 (25%)
leucine-rich repeat 284..307 CDD:275380 4/22 (18%)
leucine-rich repeat 308..333 CDD:275380 7/25 (28%)
leucine-rich repeat 334..357 CDD:275380 8/22 (36%)
leucine-rich repeat 358..381 CDD:275380 4/25 (16%)
leucine-rich repeat 382..405 CDD:275380 6/22 (27%)
leucine-rich repeat 406..429 CDD:275380 7/22 (32%)
leucine-rich repeat 430..452 CDD:275380 9/22 (41%)
leucine-rich repeat 453..500 CDD:275380 9/46 (20%)
leucine-rich repeat 501..521 CDD:275380 5/19 (26%)
leucine-rich repeat 525..547 CDD:275380 7/22 (32%)
leucine-rich repeat 548..573 CDD:275380 9/26 (35%)
leucine-rich repeat 604..640 CDD:275380 11/39 (28%)
leucine-rich repeat 641..688 CDD:275380
leucine-rich repeat 689..816 CDD:275380
LRR_8 815..875 CDD:290566
leucine-rich repeat 817..864 CDD:275380
LRR_8 864..921 CDD:290566
leucine-rich repeat 865..888 CDD:275380
leucine-rich repeat 889..910 CDD:275380
TIR 1076..1211 CDD:214587
CG32055NP_729599.1 leucine-rich repeat 76..99 CDD:275380 4/28 (14%)
leucine-rich repeat 100..123 CDD:275380 9/35 (26%)
LRR_8 128..180 CDD:290566 15/51 (29%)
leucine-rich repeat 128..147 CDD:275380 5/18 (28%)
leucine-rich repeat 148..171 CDD:275380 5/22 (23%)
leucine-rich repeat 172..192 CDD:275380 9/46 (20%)
LRR_RI <187..400 CDD:238064 63/245 (26%)
LRR_8 192..251 CDD:290566 18/61 (30%)
leucine-rich repeat 193..216 CDD:275380 7/25 (28%)
leucine-rich repeat 217..240 CDD:275380 8/22 (36%)
leucine-rich repeat 241..267 CDD:275380 4/25 (16%)
leucine-rich repeat 268..291 CDD:275380 6/22 (27%)
LRR_8 290..350 CDD:290566 22/59 (37%)
leucine-rich repeat 292..315 CDD:275380 7/22 (32%)
leucine-rich repeat 316..339 CDD:275380 9/22 (41%)
LRR_8 340..400 CDD:290566 17/81 (21%)
leucine-rich repeat 340..365 CDD:275380 8/38 (21%)
leucine-rich repeat 366..389 CDD:275380 5/30 (17%)
leucine-rich repeat 390..413 CDD:275380 7/22 (32%)
LRR_8 391..448 CDD:290566 18/56 (32%)
leucine-rich repeat 414..437 CDD:275380 8/22 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453511
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.