Sequence 1: | NP_524757.1 | Gene: | Tollo / 44497 | FlyBaseID: | FBgn0029114 | Length: | 1346 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001031980.1 | Gene: | AT5G38344 / 3771359 | AraportID: | AT5G38344 | Length: | 213 | Species: | Arabidopsis thaliana |
Alignment Length: | 208 | Identity: | 44/208 - (21%) |
---|---|---|---|
Similarity: | 79/208 - (37%) | Gaps: | 77/208 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 1059 LFYNAQKDVDKNE-----------------REKLFDAFVSYSSKD----------ELFVNEELAP 1096
Fly 1097 MLEMGEHRYKLCLHQRDFPVGGYLPETIVQAIDSSRRTIMVVSENFIKSEWCRFEFKSAHQSVLR 1161
Fly 1162 DRRRRLIVIVLGEVPQKELDPDLRLYLKTNTYLQWGD--KLF--------------WQKLRFALP 1210
Fly 1211 DVSSSQRSNVAGQ 1223 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 1 | 1.000 | 44 | 1.000 | Domainoid score | I4673 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D282372at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |