DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tollo and Gp150

DIOPT Version :10

Sequence 1:NP_524757.1 Gene:Tollo / 44497 FlyBaseID:FBgn0029114 Length:1346 Species:Drosophila melanogaster
Sequence 2:NP_477049.2 Gene:Gp150 / 37549 FlyBaseID:FBgn0013272 Length:1076 Species:Drosophila melanogaster


Alignment Length:584 Identity:139/584 - (23%)
Similarity:235/584 - (40%) Gaps:167/584 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 LSPDSFRSL-------VELRDLTIEYCKLGNLTDGSFRGLQELR--NLTIRTHNGDWSTMSLEMA 144
            :.|:.|::|       :::.:.|:||     |...:|.||.||.  |||                
  Fly   306 MGPNFFQNLGLKNVASIKIANCTLEY-----LHAEAFHGLNELYAVNLT---------------- 349

  Fly   145 SNSFVEFRQLERLDLSLNNIWLIPDGMVCPLKSLQHLNASYNKIQDISNFYFSASLSSRKARVCG 209
                       .:.|::.|    ||..| ..|.|:.|..|.|.:..:|:.::....||       
  Fly   350 -----------DVGLAIIN----PDTFV-GNKKLRMLTISGNDLSVMSSIHYLLKSSS------- 391

  Fly   210 STLQSLDLSANKMVSLPTAMLSALGRLTHLNMAKNSMSFLADRAFEGLLSLRVVDLSANRLTSLP 274
              ::.||.|.|.::.|.....|.|..:.::|:::||:..|.::|||.:..|..:|||.|.||.||
  Fly   392 --IEELDFSRNNLMELNPKAFSHLSNVVYINLSQNSLKKLPEKAFEKVTLLEELDLSYNSLTELP 454

  Fly   275 PELFAETKQLQEIYLRNNSINVLAPGIFGELAELLVLDLASNELNSQWINAATFVGLKRLMMLDL 339
            .::|..| .|..::|:.|:.|       |:|                      ..|.|.|..|||
  Fly   455 RDIFNGT-TLSILHLKYNTFN-------GDL----------------------HFGTKDLQQLDL 489

  Fly   340 SANKISRLEAHIFRPLASLQILKLEDNYIDQLPGGIFADLTNLHTLILSRNRISVIEQRTLQGLK 404
            |.|.|.::...:|                |::||     ||||:   |..|.|..|:..:...||
  Fly   490 SFNSIVQVHHSMF----------------DKMPG-----LTNLN---LKGNGIKKIQPDSFLTLK 530

  Fly   405 NLLVLSLDFNRISRMDQRSLVNCSQLQDLHLNDN-KLQAVPE----ALAHVQLLKTLDVGENMIS 464
            ||..:.|..|.:.::........|:|..:.|||| :|..:|.    :.:....:..||:....|.
  Fly   531 NLRHIDLSINDLDQISGMLFFKNSELDVIRLNDNPRLSQLPTDGFLSYSGEFTVYYLDISNCAIG 595

  Fly   465 QIENTSITQLESLYGLRMTENSLTHIRRGVFDRMSSLQILNLSQNKLKSIEAGSLQRNSQLQAIR 529
            .:.:.:.:.:..|..|::..|::.|:.|.:|..:..|..|:||.|.:..::......|.:|..:.
  Fly   596 PLGHKAFSTMPHLTTLKLAWNNINHLPREIFTGLHKLIDLDLSNNLITRMDDLIFMDNGELTKLS 660

  Fly   530 LDGNQLKSIA-GLFTELPNLVWLNISGNRLEKFDYSHIPIGLQWLDVRANRIT------QLGNYF 587
            |.||.:..:: .||..|..                      |:.|||....:|      .||..:
  Fly   661 LAGNPISRLSVRLFLPLHQ----------------------LRCLDVNDCELTTLLSDRDLGAGY 703

  Fly   588 EIESELSLSTFDASYNLLTEITASSIPNSVEVLYLNDNQISKIQPYTFFKKPNLTRVDLVRNRL 651
            :|..  ||.:|:||.||:.:|::..:.:                    ||  ||..:|:..|.|
  Fly   704 KIFD--SLRSFNASGNLIKKISSEDVKS--------------------FK--NLRSLDITNNPL 743

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TolloNP_524757.1 LRR 54..400 CDD:443914 80/319 (25%)
leucine-rich repeat 100..123 CDD:275380 7/22 (32%)
leucine-rich repeat 124..144 CDD:275380 4/21 (19%)
leucine-rich repeat 154..177 CDD:275380 5/22 (23%)
leucine-rich repeat 178..201 CDD:275380 5/22 (23%)
leucine-rich repeat 212..235 CDD:275380 7/22 (32%)
leucine-rich repeat 236..259 CDD:275380 7/22 (32%)
LRR 239..634 CDD:443914 97/406 (24%)
leucine-rich repeat 260..283 CDD:275380 11/22 (50%)
leucine-rich repeat 284..307 CDD:275380 6/22 (27%)
leucine-rich repeat 308..333 CDD:275380 1/24 (4%)
leucine-rich repeat 334..357 CDD:275380 8/22 (36%)
leucine-rich repeat 358..381 CDD:275380 4/22 (18%)
leucine-rich repeat 382..405 CDD:275380 6/22 (27%)
leucine-rich repeat 406..429 CDD:275380 3/22 (14%)
leucine-rich repeat 430..452 CDD:275380 7/26 (27%)
leucine-rich repeat 453..500 CDD:275380 9/46 (20%)
leucine-rich repeat 501..521 CDD:275380 5/19 (26%)
leucine-rich repeat 525..547 CDD:275380 7/22 (32%)
leucine-rich repeat 548..573 CDD:275380 1/24 (4%)
leucine-rich repeat 604..640 CDD:275380 4/35 (11%)
LRR_8 616..>660 CDD:404697 7/36 (19%)
leucine-rich repeat 641..688 CDD:275380 4/11 (36%)
leucine-rich repeat 689..816 CDD:275380
LRR <794..>920 CDD:443914
leucine-rich repeat 817..864 CDD:275380
leucine-rich repeat 865..888 CDD:275380
leucine-rich repeat 889..910 CDD:275380
TIR 1076..1211 CDD:214587
Gp150NP_477049.2 LRR 341..758 CDD:443914 129/544 (24%)
leucine-rich repeat 343..366 CDD:275380 9/54 (17%)
leucine-rich repeat 367..391 CDD:275380 5/23 (22%)
leucine-rich repeat 393..415 CDD:275380 7/21 (33%)
leucine-rich repeat 416..439 CDD:275380 7/22 (32%)
leucine-rich repeat 440..483 CDD:275380 18/72 (25%)
leucine-rich repeat 463..481 CDD:275380 6/46 (13%)
leucine-rich repeat 484..507 CDD:275380 9/38 (24%)
leucine-rich repeat 508..531 CDD:275380 9/25 (36%)
leucine-rich repeat 532..569 CDD:275380 10/36 (28%)
leucine-rich repeat 556..583 CDD:275380 7/26 (27%)
leucine-rich repeat 570..607 CDD:275380 4/36 (11%)
leucine-rich repeat 608..631 CDD:275380 6/22 (27%)
leucine-rich repeat 632..655 CDD:275380 6/22 (27%)
leucine-rich repeat 656..674 CDD:275380 4/17 (24%)
leucine-rich repeat 733..745 CDD:275378 4/11 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.