DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tollo and CG18480

DIOPT Version :9

Sequence 1:NP_524757.1 Gene:Tollo / 44497 FlyBaseID:FBgn0029114 Length:1346 Species:Drosophila melanogaster
Sequence 2:NP_001285960.1 Gene:CG18480 / 34920 FlyBaseID:FBgn0028518 Length:550 Species:Drosophila melanogaster


Alignment Length:184 Identity:47/184 - (25%)
Similarity:93/184 - (50%) Gaps:7/184 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 MLDLSANKISRLEAHIFRPLASLQILKLEDNYIDQLPGGIFADLTNLHTLILSRNRISVIEQRTL 400
            :||||.|.|:.::...|:....|..|.|..|.|..|.|..|.:||.|..|.||.||:..|::..|
  Fly    78 LLDLSYNDITTIDDDSFKTTIHLLNLTLAHNAIHTLYGDAFVELTRLRYLDLSYNRLEQIDEHIL 142

  Fly   401 QGLKNLLVLSLDFNRISRMDQRSLVNCSQLQDLHLNDNKL-QAVPEALAHVQLLKTLDVGENMIS 464
            :....|:.|:|:.|::|.:.:..::....|:.|:|.:::: |...:.|:.:..|:.||:.:|::.
  Fly   143 ESNNQLIHLNLEGNKLSTLGKGPILRSPSLRSLNLRNSQVNQLGTQLLSALPQLRQLDLAQNLLL 207

  Fly   465 QIENTSITQLESLYGLRMTEN------SLTHIRRGVFDRMSSLQILNLSQNKLK 512
            .:.........:|..|.:.||      :|..:..|:..|..::.:.|..:.:::
  Fly   208 TLSPGDFHAPRNLASLNVEENPFNCDRALAKVATGLRQRGVAIFMSNCMEEEVQ 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TolloNP_524757.1 LRR_RI <85..281 CDD:238064
leucine-rich repeat 100..123 CDD:275380
leucine-rich repeat 124..144 CDD:275380
LRR_8 152..222 CDD:290566
leucine-rich repeat 154..177 CDD:275380
leucine-rich repeat 178..201 CDD:275380
LRR 210..656 CDD:227223 47/184 (26%)
leucine-rich repeat 212..235 CDD:275380
leucine-rich repeat 236..259 CDD:275380
leucine-rich repeat 260..283 CDD:275380
LRR_RI 276..558 CDD:238064 47/184 (26%)
leucine-rich repeat 284..307 CDD:275380
leucine-rich repeat 308..333 CDD:275380
leucine-rich repeat 334..357 CDD:275380 7/20 (35%)
leucine-rich repeat 358..381 CDD:275380 9/22 (41%)
leucine-rich repeat 382..405 CDD:275380 8/22 (36%)
leucine-rich repeat 406..429 CDD:275380 5/22 (23%)
leucine-rich repeat 430..452 CDD:275380 5/22 (23%)
leucine-rich repeat 453..500 CDD:275380 11/52 (21%)
leucine-rich repeat 501..521 CDD:275380 1/12 (8%)
leucine-rich repeat 525..547 CDD:275380
leucine-rich repeat 548..573 CDD:275380
leucine-rich repeat 604..640 CDD:275380
leucine-rich repeat 641..688 CDD:275380
leucine-rich repeat 689..816 CDD:275380
LRR_8 815..875 CDD:290566
leucine-rich repeat 817..864 CDD:275380
LRR_8 864..921 CDD:290566
leucine-rich repeat 865..888 CDD:275380
leucine-rich repeat 889..910 CDD:275380
TIR 1076..1211 CDD:214587
CG18480NP_001285960.1 LRR_8 74..134 CDD:290566 22/55 (40%)
LRR_RI <76..230 CDD:238064 43/151 (28%)
leucine-rich repeat 76..99 CDD:275380 7/20 (35%)
leucine-rich repeat 100..123 CDD:275380 9/22 (41%)
LRR_8 122..182 CDD:290566 17/59 (29%)
leucine-rich repeat 124..147 CDD:275380 8/22 (36%)
leucine-rich repeat 148..171 CDD:275380 5/22 (23%)
LRR_8 170..230 CDD:290566 13/59 (22%)
leucine-rich repeat 172..195 CDD:275380 5/22 (23%)
leucine-rich repeat 196..219 CDD:275380 4/22 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453663
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.