DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tollo and CG16974

DIOPT Version :10

Sequence 1:NP_524757.1 Gene:Tollo / 44497 FlyBaseID:FBgn0029114 Length:1346 Species:Drosophila melanogaster
Sequence 2:NP_609610.2 Gene:CG16974 / 34713 FlyBaseID:FBgn0032479 Length:1257 Species:Drosophila melanogaster


Alignment Length:97 Identity:21/97 - (21%)
Similarity:33/97 - (34%) Gaps:27/97 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 DHPEEEKKGLVEKIKEKLPGHHD------------------EKAEDSPAVTSTPLVVTEHPVEPT 223
            |.|:|......:::.:.|...:|                  ||...|....||..::.......|
  Fly     4 DVPDENNNVAADELTDSLVPFYDGKNVLVTGGTGFLGKVLIEKLLRSCVGISTVYMLLRPKRGMT 68

  Fly   224 TELP----VEHPEEKKGILEKIKEKLPGYHAK 251
            :|..    |.||     :.|:|:.|.|...||
  Fly    69 SEQRYREFVRHP-----VFERIRSKTPQLLAK 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TolloNP_524757.1 LRR 54..400 CDD:443914 21/97 (22%)
leucine-rich repeat 100..123 CDD:275380
leucine-rich repeat 124..144 CDD:275380
leucine-rich repeat 154..177 CDD:275380 21/97 (22%)
leucine-rich repeat 178..201 CDD:275380 4/40 (10%)
leucine-rich repeat 212..235 CDD:275380 5/26 (19%)
leucine-rich repeat 236..259 CDD:275380 6/16 (38%)
LRR 239..634 CDD:443914 6/13 (46%)
leucine-rich repeat 260..283 CDD:275380
leucine-rich repeat 284..307 CDD:275380
leucine-rich repeat 308..333 CDD:275380
leucine-rich repeat 334..357 CDD:275380
leucine-rich repeat 358..381 CDD:275380
leucine-rich repeat 382..405 CDD:275380
leucine-rich repeat 406..429 CDD:275380
leucine-rich repeat 430..452 CDD:275380
leucine-rich repeat 453..500 CDD:275380
leucine-rich repeat 501..521 CDD:275380
leucine-rich repeat 525..547 CDD:275380
leucine-rich repeat 548..573 CDD:275380
leucine-rich repeat 604..640 CDD:275380
LRR_8 616..>660 CDD:404697
leucine-rich repeat 641..688 CDD:275380
leucine-rich repeat 689..816 CDD:275380
LRR <794..>920 CDD:443914
leucine-rich repeat 817..864 CDD:275380
leucine-rich repeat 865..888 CDD:275380
leucine-rich repeat 889..910 CDD:275380
TIR 1076..1211 CDD:214587
CG16974NP_609610.2 leucine-rich repeat 206..228 CDD:275380
leucine-rich repeat 229..252 CDD:275380
LRR <230..531 CDD:443914
leucine-rich repeat 253..276 CDD:275380
leucine-rich repeat 277..300 CDD:275380
leucine-rich repeat 301..324 CDD:275380
leucine-rich repeat 325..348 CDD:275380
leucine-rich repeat 349..372 CDD:275380
leucine-rich repeat 373..396 CDD:275380
leucine-rich repeat 397..420 CDD:275380
leucine-rich repeat 421..444 CDD:275380
leucine-rich repeat 478..502 CDD:275380
leucine-rich repeat 503..526 CDD:275380
Ig <714..761 CDD:472250
Ig strand C 714..718 CDD:409358
Ig strand E 734..738 CDD:409358
Ig strand F 748..753 CDD:409358
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.