DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tollo and Tlr8

DIOPT Version :10

Sequence 1:NP_524757.1 Gene:Tollo / 44497 FlyBaseID:FBgn0029114 Length:1346 Species:Drosophila melanogaster
Sequence 2:NP_573475.2 Gene:Tlr8 / 170744 MGIID:2176887 Length:1032 Species:Mus musculus


Alignment Length:120 Identity:23/120 - (19%)
Similarity:44/120 - (36%) Gaps:30/120 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ETPTVATEESPATTTEVTDRGLFDFLGKKEEEVKPQETTTLESEFDHKAQISEPELAAEHEEVKE 77
            |:.|.::.||...::.:..|                 :.:|...|.|:.|          .:|.:
Mouse   209 ESDTCSSAESSPFSSPLLSR-----------------SASLLKIFTHETQ----------AKVAK 246

  Fly    78 NKITLLEELQEKTEE--DEENKPSVIEKLHRSNSSSSSSSDE-EGEEKKEKKKKI 129
            .|.|........|:|  ..|..|:|..:.|.|:..:..:.|. .|.:::.|:..|
Mouse   247 GKRTFARHSSLSTDECSSAEPSPNVPRRSHCSSLQAGGALDHLHGGDRQHKEHTI 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TolloNP_524757.1 LRR 54..400 CDD:443914 17/79 (22%)
leucine-rich repeat 100..123 CDD:275380 5/23 (22%)
leucine-rich repeat 124..144 CDD:275380 2/6 (33%)
leucine-rich repeat 154..177 CDD:275380
leucine-rich repeat 178..201 CDD:275380
leucine-rich repeat 212..235 CDD:275380
leucine-rich repeat 236..259 CDD:275380
LRR 239..634 CDD:443914
leucine-rich repeat 260..283 CDD:275380
leucine-rich repeat 284..307 CDD:275380
leucine-rich repeat 308..333 CDD:275380
leucine-rich repeat 334..357 CDD:275380
leucine-rich repeat 358..381 CDD:275380
leucine-rich repeat 382..405 CDD:275380
leucine-rich repeat 406..429 CDD:275380
leucine-rich repeat 430..452 CDD:275380
leucine-rich repeat 453..500 CDD:275380
leucine-rich repeat 501..521 CDD:275380
leucine-rich repeat 525..547 CDD:275380
leucine-rich repeat 548..573 CDD:275380
leucine-rich repeat 604..640 CDD:275380
LRR_8 616..>660 CDD:404697
leucine-rich repeat 641..688 CDD:275380
leucine-rich repeat 689..816 CDD:275380
LRR <794..>920 CDD:443914
leucine-rich repeat 817..864 CDD:275380
leucine-rich repeat 865..888 CDD:275380
leucine-rich repeat 889..910 CDD:275380
TIR 1076..1211 CDD:214587
Tlr8NP_573475.2 LRR 1 41..61
LRR 2 62..85
leucine-rich repeat 65..88 CDD:275380
LRR 66..484 CDD:443914 23/120 (19%)
LRR 3 87..109
leucine-rich repeat 89..122 CDD:275380
LRR 4 120..143
leucine-rich repeat 123..143 CDD:275380
leucine-rich repeat 144..167 CDD:275380
LRR 5 145..165
LRR 6 166..194
leucine-rich repeat 168..197 CDD:275380
LRR 7 195..218 2/8 (25%)
leucine-rich repeat 198..218 CDD:275380 2/8 (25%)
leucine-rich repeat 219..242 CDD:275380 5/49 (10%)
LRR 8 220..239 3/35 (9%)
LRR 9 240..267 6/36 (17%)
leucine-rich repeat 243..283 CDD:275380 10/39 (26%)
LRR 10 281..304 4/21 (19%)
leucine-rich repeat 284..307 CDD:275380 4/18 (22%)
LRR 11 306..329
leucine-rich repeat 308..327 CDD:275380
LRR 12 331..360
leucine-rich repeat 334..363 CDD:275380
LRR 13 361..384
leucine-rich repeat 364..390 CDD:275380
LRR 14 388..411
leucine-rich repeat 391..414 CDD:275380
LRR 15 413..436
leucine-rich repeat 465..497 CDD:275380
LRR 16 471..494
LRR_8 501..555 CDD:404697
leucine-rich repeat 501..522 CDD:275380
LRR 17 520..543
leucine-rich repeat 523..546 CDD:275380
LRR <532..791 CDD:443914
LRR 18 545..572
leucine-rich repeat 547..576 CDD:275380
LRR 19 574..598
leucine-rich repeat 577..600 CDD:275380
LRR 20 600..621
leucine-rich repeat 601..631 CDD:275380
LRR 21 629..652
leucine-rich repeat 632..656 CDD:275380
LRR 22 654..677
leucine-rich repeat 657..680 CDD:275380
LRR 23 678..701
leucine-rich repeat 681..704 CDD:275380
LRR 24 702..725
leucine-rich repeat 705..728 CDD:275380
LRR 25 727..749
leucine-rich repeat 729..748 CDD:275380
LRR 26 752..776
TIR 871..1007 CDD:214587
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.