DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tollo and Il1rap

DIOPT Version :10

Sequence 1:NP_524757.1 Gene:Tollo / 44497 FlyBaseID:FBgn0029114 Length:1346 Species:Drosophila melanogaster
Sequence 2:NP_001152790.1 Gene:Il1rap / 16180 MGIID:104975 Length:685 Species:Mus musculus


Alignment Length:435 Identity:101/435 - (23%)
Similarity:175/435 - (40%) Gaps:83/435 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   932 LRDYINRHEYVVDKLKMKCDVISGNSTQQMVIYPGSGEPASLPVVQCSQTLPLGLDNNF-NYAEQ 995
            :.|..|...:.:|. |...||....:..:.|.|..:.:.....::...:..|..|..|: .:|..
Mouse   273 IMDSHNEVWWTIDG-KKPDDVTVDITINESVSYSSTEDETRTQILSIKKVTPEDLRRNYVCHARN 336

  Fly   996 AGGENASNATSTKMILNQPPKLDYIPILVAILTAFIFVMICISLVF-IFRQEMRVWCHSRFGVRL 1059
            ..||....|...:.::  ||:  |...|.....|.:|:::.:.:|: ::..||          .|
Mouse   337 TKGEAEQAAKVKQKVI--PPR--YTVELACGFGATVFLVVVLIVVYHVYWLEM----------VL 387

  Fly  1060 FYNAQKDVDKNERE-KLFDAFVSYSS--KDELFVNEELAPMLEMGEHRYKLCLHQRDFPVGGYLP 1121
            ||.|....|:...: |.:|.:|||:.  ::|.||...|..:|| .|..||||:..||...||...
Mouse   388 FYRAHFGTDETILDGKEYDIYVSYARNVEEEEFVLLTLRGVLE-NEFGYKLCIFDRDSLPGGNTV 451

  Fly  1122 ETIVQAIDSSRRTIMVVSENFI-KSEWCRFEFKSAHQSVLRDRRRRLIVIVLGEVPQKELDPDLR 1185
            |.:...|..|||.|:|:|.::: :......|||   ..|:........:||:...|.::..|.:.
Mouse   452 EAVFDFIQRSRRMIVVLSPDYVTEKSISMLEFK---LGVMCQNSIATKLIVVEYRPLEQPHPGIM 513

  Fly  1186 LYLKTNTYLQW-GDK------LFWQKLRFALPDVSSSQRSNVAGQSCHVPINHASYHHHHHVHQQ 1243
            ...::.:::.| |:|      .||:.||.||| :.|...|:...:||                  
Mouse   514 QLKESVSFVSWKGEKSKHSGSKFWKALRLALP-LRSLSASSGWNESC------------------ 559

  Fly  1244 AMPLPHSVHHHQQQFMLPPPPQ------------QPGSF---RRQPS---------LHQQQQQQQ 1284
            :.....|:.|.|::..|..||:            .||:.   |.:||         ...:...:.
Mouse   560 SSQSDISLDHVQRRSRLKEPPELRSSERVSGAEPAPGTMSKHRGKPSAACRCCVTYCEGESHLRS 624

  Fly  1285 QIRGNNNTTQQQQ--------QQQAALLMGGGSVGGPAPQMIPLA 1321
            :.|...:|..|.:        |:..:..:..|:...||||:..||
Mouse   625 KSRAEMHTHPQWETHLCKPPLQESESQWIQNGTRPEPAPQISALA 669

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TolloNP_524757.1 LRR 54..400 CDD:443914
leucine-rich repeat 100..123 CDD:275380
leucine-rich repeat 124..144 CDD:275380
leucine-rich repeat 154..177 CDD:275380
leucine-rich repeat 178..201 CDD:275380
leucine-rich repeat 212..235 CDD:275380
leucine-rich repeat 236..259 CDD:275380
LRR 239..634 CDD:443914
leucine-rich repeat 260..283 CDD:275380
leucine-rich repeat 284..307 CDD:275380
leucine-rich repeat 308..333 CDD:275380
leucine-rich repeat 334..357 CDD:275380
leucine-rich repeat 358..381 CDD:275380
leucine-rich repeat 382..405 CDD:275380
leucine-rich repeat 406..429 CDD:275380
leucine-rich repeat 430..452 CDD:275380
leucine-rich repeat 453..500 CDD:275380
leucine-rich repeat 501..521 CDD:275380
leucine-rich repeat 525..547 CDD:275380
leucine-rich repeat 548..573 CDD:275380
leucine-rich repeat 604..640 CDD:275380
LRR_8 616..>660 CDD:404697
leucine-rich repeat 641..688 CDD:275380
leucine-rich repeat 689..816 CDD:275380
LRR <794..>920 CDD:443914
leucine-rich repeat 817..864 CDD:275380
leucine-rich repeat 865..888 CDD:275380
leucine-rich repeat 889..910 CDD:275380
TIR 1076..1211 CDD:214587 44/144 (31%)
Il1rapNP_001152790.1 Ig1_IL1R_like 25..132 CDD:409584
Ig strand A 26..29 CDD:409584
Ig strand A' 34..38 CDD:409584
Ig strand B 42..47 CDD:409584
Ig strand C 67..71 CDD:409584
Ig strand C' 80..82 CDD:409584
Ig strand D 91..95 CDD:409584
Ig strand E 97..101 CDD:409584
Ig strand F 110..118 CDD:409584
Ig strand G 121..132 CDD:409584
Ig 145..235 CDD:472250
Ig strand B 156..160 CDD:409585
Ig strand C 174..178 CDD:409585
Ig strand E 195..199 CDD:409585
Ig strand F 209..214 CDD:409585
Ig strand G 226..229 CDD:409585
Ig3_IL1RAP 243..349 CDD:409525 15/76 (20%)
Ig strand A 243..246 CDD:409525
Ig strand A' 254..258 CDD:409525
Ig strand B 260..269 CDD:409525
Ig strand C 278..283 CDD:409525 1/4 (25%)
Ig strand C' 286..288 CDD:409525 0/2 (0%)
Ig strand D 296..304 CDD:409525 1/7 (14%)
Ig strand E 310..318 CDD:409525 0/7 (0%)
Ig strand F 329..335 CDD:409525 1/5 (20%)
Ig strand G 339..345 CDD:409525 2/5 (40%)
TIR 404..547 CDD:214587 45/147 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.