DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba2 and UBA3

DIOPT Version :9

Sequence 1:NP_524756.2 Gene:Uba2 / 44496 FlyBaseID:FBgn0029113 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_003959.3 Gene:UBA3 / 9039 HGNCID:12470 Length:463 Species:Homo sapiens


Alignment Length:571 Identity:142/571 - (24%)
Similarity:208/571 - (36%) Gaps:222/571 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FPP---TLQELVKKSKVLVVGAGGIGCEVLKNLVLSGFTDIEIIDLDTIDLSNLNRQFLFHREHV 70
            |.|   :||.|:...||||:||||:|||:||||.||||..|.:||:||||:|||||||||..:.:
Human    56 FEPSTESLQFLLDTCKVLVIGAGGLGCELLKNLALSGFRQIHVIDMDTIDVSNLNRQFLFRPKDI 120

  Fly    71 GKSKARVARESALSFNPDAKITAYHDSVTSTDYGVNFFKKFDLVLSALDNRAARNHVNRMCL--- 132
            |:.||.||.|......|:..:..:.:.:  .|:...|:::|.:::..||:..||..:|.|.:   
Human   121 GRPKAEVAAEFLNDRVPNCNVVPHFNKI--QDFNDTFYRQFHIIVCGLDSIIARRWINGMLISLL 183

  Fly   133 ---------NADVPLIESGTAGYNGQVELIKRGLTQCYECTPK--DKQRSFPGCTIRNTPSEPIH 186
                     ::.||||:.||.|:.|...:|..|:|.|.|||.:  ..|.:||.|||.:.|..|.|
Human   184 NYEDGVLDPSSIVPLIDGGTEGFKGNARVILPGMTACIECTLELYPPQVNFPMCTIASMPRLPEH 248

  Fly   187 CIVWAKHLFNQLFGESLEDEDISPDAADPDAKEKDGGDGNGEPKGDGKEKGEESKEEKEAKEDTA 251
            ||.:.:.|                                                         
Human   249 CIEYVRML--------------------------------------------------------- 256

  Fly   252 NGNIMRINTRQWAKDCNYDAGKLFNKFFNEDITYLLRMSNLWKTRKAPVPVQWDTLLPEGSSGDQ 316
                      ||.|:..:..|                           ||:..|.  ||      
Human   257 ----------QWPKEQPFGEG---------------------------VPLDGDD--PE------ 276

  Fly   317 KDVAKQHHKVWSIEECAQVFANSLKELSANFLKLEGDDTLAWDKDDQPAMDFVAACANVRSHIFD 381
                   |..|       :|..||                                         
Human   277 -------HIQW-------IFQKSL----------------------------------------- 286

  Fly   382 IERKSRFEIK--------SMAGNIIPAIATTNAITAGISVMRAFKVLEAKWEQCKAVYARLRPNA 438
             ||.|::.|:        .:...||||:|:|||:.|.:.....||:       ..:.|..|    
Human   287 -ERASQYNIRGVTYRLTQGVVKRIIPAVASTNAVIAAVCATEVFKI-------ATSAYIPL---- 339

  Fly   439 RNHFLVPDASLPG---------PNPNCHVCASDPA-ITLKIDTKRMRI---------KELRDEVL 484
             |::||.: .:.|         ...||..|:..|. |......|...:         .:::...:
Human   340 -NNYLVFN-DVDGLYTYTFEAERKENCPACSQLPQNIQFSPSAKLQEVLDYLTNSASLQMKSPAI 402

  Fly   485 VKTLNMLNPDVTVQSNGSILISSEEGETECNDGKLLSELNIVDGVILKCDD 535
            ..||...|..:.:||     ::|.|..|..|..|.|.||.:|||..|...|
Human   403 TATLEGKNRTLYLQS-----VTSIEERTRPNLSKTLKELGLVDGQELAVAD 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba2NP_524756.2 ThiF 7..>177 CDD:279270 75/184 (41%)
Uba2_SUMO 21..459 CDD:238766 115/468 (25%)
UAE_UbL 467..552 CDD:291402 19/78 (24%)
UBA2_C 573..691 CDD:292812
UBA3NP_003959.3 Interaction with UBE2M N-terminus 53..70 5/13 (38%)
Uba3_RUB 71..368 CDD:238765 115/469 (25%)
Interaction with UBE2M N-terminus 157..161 1/3 (33%)
Interaction with UBE2M N-terminus 192..217 9/24 (38%)
Interaction with NEDD8 227..229 0/1 (0%)
Interaction with NAE1. /evidence=ECO:0000269|PubMed:12740388 242..248 2/5 (40%)
Interaction with NAE1. /evidence=ECO:0000269|PubMed:12740388 292..295 0/2 (0%)
Interaction with UBE2M N-terminus 331..338 1/13 (8%)
Interaction with NEDD8 352..357 0/4 (0%)
Interaction with UBE2M core domain 368..463 21/86 (24%)
E2_bind 376..461 CDD:400951 19/78 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D686413at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.