DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba2 and UBA3

DIOPT Version :9

Sequence 1:NP_524756.2 Gene:Uba2 / 44496 FlyBaseID:FBgn0029113 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_015391.1 Gene:UBA3 / 856179 SGDID:S000006270 Length:299 Species:Saccharomyces cerevisiae


Alignment Length:180 Identity:70/180 - (38%)
Similarity:106/180 - (58%) Gaps:18/180 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KVLVVGAGGIGCEVLKNLVLSGFT-DIEIIDLDTIDLSNLNRQFLFHREHVGKSKARVARESALS 84
            |:||:||||:|||:||||.:..|. .:.|:|:|||:|:||||||||..:.:||.||:||.:...:
Yeast     4 KILVLGAGGLGCEILKNLTMLSFVKQVHIVDIDTIELTNLNRQFLFCDKDIGKPKAQVAAQYVNT 68

  Fly    85 FNPDAKITAYHDSVTSTDYGVNFFKKFDLVLSALDNRAARNHVN----RMCLNAD----VPLIES 141
            ..|..::.|:...:|:..  .:|:|.|..::|.||....|..:|    ::.|.::    :|.|:.
Yeast    69 RFPQLEVVAHVQDLTTLP--PSFYKDFQFIISGLDAIEPRRFINETLVKLTLESNYEICIPFIDG 131

  Fly   142 GTAGYNGQVELIKRGLTQCYEC---TPKDKQRSFPGCTIRNTPSEPIHCI 188
            ||.|..|.|:.|..|:|.|:||   |...:|.:.|.|||.|.|    .||
Yeast   132 GTEGLKGHVKTIIPGITACWECSIDTLPSQQDTVPMCTIANNP----RCI 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba2NP_524756.2 ThiF 7..>177 CDD:279270 64/167 (38%)
Uba2_SUMO 21..459 CDD:238766 70/180 (39%)
UAE_UbL 467..552 CDD:291402
UBA2_C 573..691 CDD:292812
UBA3NP_015391.1 Uba3_RUB 4..294 CDD:238765 70/180 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.