DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba2 and ULA1

DIOPT Version :9

Sequence 1:NP_524756.2 Gene:Uba2 / 44496 FlyBaseID:FBgn0029113 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_015322.1 Gene:ULA1 / 856104 SGDID:S000005924 Length:462 Species:Saccharomyces cerevisiae


Alignment Length:468 Identity:89/468 - (19%)
Similarity:158/468 - (33%) Gaps:139/468 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 QELVKKSKVLVVG-AGGIGCEVLKNLVLSGFTDIEIIDLDTI-------------DLSNLNRQFL 64
            |:.:.:|:|.||| |..:..||.|||||:|.:.:..:.::..             ||..|..:.|
Yeast    16 QDSLNRSRVCVVGPATPLLQEVFKNLVLAGISSLTWLKVECAVQSGSLFLAELKKDLEPLASKQL 80

  Fly    65 FHREHVGKSKARVARESALSFNPDAKITAYHDSVTSTDYGVNFFKKFDLVLSALDNRAAR---NH 126
            .:.|:                  |.:.|........|.:.|       ::|:.:..:.|.   |.
Yeast    81 EYEEN------------------DLRKTLQQPQYDWTRFSV-------VILTCIGEQTAMLDLNE 120

  Fly   127 VNRMCLNADVPLIESGTAGYNGQVELIKRGLTQCYECTPKDKQRSFPGCTIRNTPSEPIHCIVWA 191
            :.|.......|::.:..:|:.|.:.|:........:..|..|:...   .::|.         |.
Yeast   121 IRRQRGTKFPPVLNTFVSGFYGYIYLVLSETHFVLQAHPDSKKYDL---RLQNP---------WP 173

  Fly   192 KHLFNQLFGESLEDEDISPDAADP--------DAK-EKDGGDGNGEPKGDGKEK---------GE 238
            : |.|.:....|...|.:..:..|        .|| |:||  .||....|..:|         |.
Yeast   174 E-LINYVDTFDLSKMDTATFSGIPYTVLLMKCIAKLERDG--NNGRITIDQMKKVLDQICLPLGN 235

  Fly   239 ESKEEK---EAK----------------EDTANGNIMRINTRQWAKDCNYDAGKLFNKFFNEDIT 284
            :...|.   |||                ||......:......|....||           |.:|
Yeast   236 DVIYEPNYVEAKRYAYLACSQNDCCKELEDLLRNLEISDYGNDWHDTYNY-----------EILT 289

  Fly   285 YLLRMSNLWKTRKAPVPVQWDTLLPEGSSGDQKDVAKQHHKVWSIEEC-AQVFANSLKELSANFL 348
            .||.:.|:.|...   .:.:..|  .|:..|.:...:.:.::..:.|. |::..:.::|..|...
Yeast   290 LLLTLKNIAKENG---ELSFQPL--TGTLPDMESTTENYIRLKKLYEVKAKLDKSRVEESLARSK 349

  Fly   349 KLEGDDTLAWDKDDQPAMDFVAACANVRSHIFDIERKSRFEIKSMAGNIIPAIATTNAITAGISV 413
            |:...|.|.            ..|    ||..::.:     |.....:::...:|:||:...: |
Yeast   350 KIVSQDVLE------------TFC----SHYGEVRK-----ILPPKSDLLGIFSTSNALLDAL-V 392

  Fly   414 MRAFKVLEAKWEQ 426
            |..|      |||
Yeast   393 MVQF------WEQ 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba2NP_524756.2 ThiF 7..>177 CDD:279270 34/179 (19%)
Uba2_SUMO 21..459 CDD:238766 87/461 (19%)
UAE_UbL 467..552 CDD:291402
UBA2_C 573..691 CDD:292812
ULA1NP_015322.1 E1_enzyme_family 2..460 CDD:304554 89/468 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.