DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba2 and Uba5

DIOPT Version :9

Sequence 1:NP_524756.2 Gene:Uba2 / 44496 FlyBaseID:FBgn0029113 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_079968.2 Gene:Uba5 / 66663 MGIID:1913913 Length:403 Species:Mus musculus


Alignment Length:162 Identity:45/162 - (27%)
Similarity:77/162 - (47%) Gaps:14/162 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VKKSKVLVVGAGGIGCEVLKNLVLSGFTDIEIIDLDTIDLSNLNRQFLFHREHVGKSKARVARES 81
            ::...|.:||.||:|....:.|...|...:.:.|.|.::|:|:||.| |.....|.||...|..:
Mouse    69 IRTYAVAIVGVGGVGSVTAEMLTRCGIGKLLLFDYDKVELANMNRLF-FQPYQAGLSKVHAAEHT 132

  Fly    82 ALSFNPDAKITAYHDSVTSTDYGVNFFKKF-----------DLVLSALDNRAARNHVNRMCLNAD 135
            ..:.|||.....::.::|:.::..:|..:.           |||||.:||..||..:|..|....
Mouse   133 LRNINPDVLFEVHNYNITTVEHFEHFMNRISNGGLEEGQPVDLVLSCVDNFEARMAINTACNELG 197

  Fly   136 VPLIESGTA--GYNGQVELIKRGLTQCYECTP 165
            ...:|||.:  ..:|.::|:..|.:.|:.|.|
Mouse   198 QTWMESGVSENAVSGHIQLMIPGESACFACAP 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba2NP_524756.2 ThiF 7..>177 CDD:279270 45/162 (28%)
Uba2_SUMO 21..459 CDD:238766 45/158 (28%)
UAE_UbL 467..552 CDD:291402
UBA2_C 573..691 CDD:292812
Uba5NP_079968.2 ThiF_MoeB_HesA_family 50..293 CDD:238386 45/162 (28%)
ThiF 51..307 CDD:279270 45/162 (28%)
UFM1-interacting sequence (UIS). /evidence=ECO:0000250|UniProtKB:Q9GZZ9 333..345
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.