DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba2 and UBA6

DIOPT Version :9

Sequence 1:NP_524756.2 Gene:Uba2 / 44496 FlyBaseID:FBgn0029113 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_060697.4 Gene:UBA6 / 55236 HGNCID:25581 Length:1052 Species:Homo sapiens


Alignment Length:495 Identity:140/495 - (28%)
Similarity:209/495 - (42%) Gaps:106/495 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AINGVFPPTLQELVKKSKVLVVGAGGIGCEVLKNLVLSGFTD------IEIIDLDTIDLSNLNRQ 62
            |:......||.:.::...:.:||.|.||||:|||..|.|...      |.:.|.|.|:.||||||
Human   445 ALRACIGDTLCQKLQNLNIFLVGCGAIGCEMLKNFALLGVGTSKEKGMITVTDPDLIEKSNLNRQ 509

  Fly    63 FLFHREHVGKSKARVARESALSFNPDAKITAYHDSV---TSTDYGVNFFKKFDLVLSALDNRAAR 124
            |||...|:.|.|:..|.::.|..|...||.|:.:.|   |.|.|...|:.|.|::::||||..||
Human   510 FLFRPHHIQKPKSYTAADATLKINSQIKIDAHLNKVCPTTETIYNDEFYTKQDVIITALDNVEAR 574

  Fly   125 NHVNRMCLNADVPLIESGTAGYNGQVELIKRGLTQCYECTPKDKQRSFPGCTIRNTPSEPIHCIV 189
            .:|:..||....||::|||.|..|..|:|...||:.|.......:...|.||:::.|:...|.|.
Human   575 RYVDSRCLANLRPLLDSGTMGTKGHTEVIVPHLTESYNSHRDPPEEEIPFCTLKSFPAAIEHTIQ 639

  Fly   190 WAKHLFNQLFGESLEDEDISPDAADPDAKEKDGGDGNGEPKGDGKEKGEESKEEKEAKEDTANG- 253
            ||:..|...|...            |....|..             :...|.||...|..:.:. 
Human   640 WARDKFESSFSHK------------PSLFNKFW-------------QTYSSAEEVLQKIQSGHSL 679

  Fly   254 -------NIMRINTRQWAKDCNYDAGKLFNKFFNEDITYLLRM----------SNLWKT-RKAPV 300
                   .::....|.|:: |...|...|.|:||.....||..          |..|:: ::.|.
Human   680 EGCFQVIKLLSRRPRNWSQ-CVELARLKFEKYFNHKALQLLHCFPLDIRLKDGSLFWQSPKRPPS 743

  Fly   301 PVQWDTLLPEGSSGDQKDVAKQHHKVWSI---EE--CAQVFANSLKELSANFLK-----LEGDDT 355
            |:::|...|...|..| :.||.:..|:.|   ||  .|....|.|.|:.....|     ::.|:|
Human   744 PIKFDLNEPLHLSFLQ-NAAKLYATVYCIPFAEEDLSADALLNILSEVKIQEFKPSNKVVQTDET 807

  Fly   356 ---------------------------------------LAWDKDD--QPAMDFVAACANVRSHI 379
                                                   |:::|||  ...:||:.|.:|:|:.:
Human   808 ARKPDHVPISSEDERNAIFQLEKAILSNEATKSDLQMAVLSFEKDDDHNGHIDFITAASNLRAKM 872

  Fly   380 FDIERKSRFEIKSMAGNIIPAIATTNAITAGISVMRAFKV 419
            :.||...||:.|.:||.||||||||.|..:|:..:...||
Human   873 YSIEPADRFKTKRIAGKIIPAIATTTATVSGLVALEMIKV 912

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba2NP_524756.2 ThiF 7..>177 CDD:279270 66/178 (37%)
Uba2_SUMO 21..459 CDD:238766 137/478 (29%)
UAE_UbL 467..552 CDD:291402
UBA2_C 573..691 CDD:292812
UBA6NP_060697.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
Ube1 38..1046 CDD:273603 140/495 (28%)
Ube1_repeat1 43..432 CDD:238768
E1_4HB 299..361 CDD:292809
Ube1_repeat2 462..1005 CDD:238767 137/478 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.