DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba2 and uba5

DIOPT Version :9

Sequence 1:NP_524756.2 Gene:Uba2 / 44496 FlyBaseID:FBgn0029113 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_001004790.1 Gene:uba5 / 448010 XenbaseID:XB-GENE-955661 Length:399 Species:Xenopus tropicalis


Alignment Length:405 Identity:94/405 - (23%)
Similarity:143/405 - (35%) Gaps:139/405 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ELVKKSKVLVVGAGGIGCEVLKNLVLSGFTDIEIIDLDTIDLSNLNRQFLFHREHVGKSKARVAR 79
            |.::...|.|||.||:|....:.|...|...:.:.|.|.::::|:||.| |.....|.||...|.
 Frog    65 EKIRTFTVAVVGVGGVGSVTAEMLTRCGIGKLLLFDYDKVEMANMNRLF-FQPHQAGLSKVEAAE 128

  Fly    80 ESALSFNPDAKITAYHDSVTSTDYGVNFFKKF-----------DLVLSALDNRAARNHVNRMCLN 133
            .:..:.|||.:...::.::|:.|...:|..:.           |||||.:||..||..:|..|..
 Frog   129 HTLRNINPDVQFEVHNYNITTLDNFQHFMDRISKGGLKEGTPVDLVLSCVDNFEARMAINTACNE 193

  Fly   134 ADVPLIESGTA--GYNGQVELIKRGLTQCYECTP----------KDKQR------SFP------- 173
            .....:|||.:  ..:|.::|||.|.|.|:.|.|          |..:|      |.|       
 Frog   194 LVQIWMESGVSENAVSGHIQLIKPGETACFACAPPLVVAANIDEKTLKREGVCAASLPTTMGVVA 258

  Fly   174 GCTIRNTPSEPIHCIVWAKHLFNQLFG--------ESLED------EDISPDAAD-------PDA 217
            |..::|.          .|:|.|  ||        .:::|      ...:|...|       .:.
 Frog   259 GMLVQNV----------LKYLLN--FGTVSFYLGYNAMQDFFPTMAMKPNPQCGDKYCRKQQEEF 311

  Fly   218 KEKDGGDGNGEPKGDGKEKGEESKEEKEAKEDTANGNIMRINTRQWAKDCNYDAGKLFNKFFNED 282
            |.|:......||        ...|||:...||           ..|..:       |.::...|:
 Frog   312 KLKEAARPKQEP--------IVVKEEEIVHED-----------NDWGIE-------LVSEVSEEE 350

  Fly   283 ITYLLRMSNLWKTRKAPVPVQWDTLLPEG------------SSGDQKDVAKQHHKVWSIEECAQV 335
            :          |....|||.     ||||            :||            :.:|:..| 
 Frog   351 L----------KAASGPVPE-----LPEGIKVAYTVPITEPTSG------------FIVEDSEQ- 387

  Fly   336 FANSLKELSANFLKL 350
               ||.||.|....|
 Frog   388 ---SLDELMAQMKNL 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba2NP_524756.2 ThiF 7..>177 CDD:279270 55/197 (28%)
Uba2_SUMO 21..459 CDD:238766 93/399 (23%)
UAE_UbL 467..552 CDD:291402
UBA2_C 573..691 CDD:292812
uba5NP_001004790.1 ThiF_MoeB_HesA_family 48..293 CDD:238386 62/240 (26%)
UFM1-interacting sequence (UIS). /evidence=ECO:0000250|UniProtKB:Q9GZZ9 331..343 3/29 (10%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.