DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba2 and mocs3

DIOPT Version :9

Sequence 1:NP_524756.2 Gene:Uba2 / 44496 FlyBaseID:FBgn0029113 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_956421.1 Gene:mocs3 / 393095 ZFINID:ZDB-GENE-040426-782 Length:459 Species:Danio rerio


Alignment Length:150 Identity:44/150 - (29%)
Similarity:71/150 - (47%) Gaps:1/150 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 QELVKKSKVLVVGAGGIGCEVLKNLVLSGFTDIEIIDLDTIDLSNLNRQFLFHREHVGKSKARVA 78
            |..:....|||||.||:||.:.:.|..:|...:.::|.|.::||||:||.|......|:.||..|
Zfish    77 QIAISNISVLVVGCGGLGCPLAQYLAAAGIGRLGLLDYDVVELSNLHRQVLHTELTQGQPKALSA 141

  Fly    79 RESALSFNPDAKITAYHDSVTSTDYGVNFFKKFDLVLSALDNRAARNHVNRMCLNADVPLIESGT 143
            .::....|...:...||..: |.:..:...:::|:|....||...|..||..|:....||:.:..
Zfish   142 AQAISRMNSTVQCVPYHLQL-SRENAIQLIQQYDIVADCSDNVPTRYLVNDACVLTSRPLVSASA 205

  Fly   144 AGYNGQVELIKRGLTQCYEC 163
            ....||:.:.......||.|
Zfish   206 LRMEGQLTVYNYRGGPCYRC 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba2NP_524756.2 ThiF 7..>177 CDD:279270 43/149 (29%)
Uba2_SUMO 21..459 CDD:238766 42/142 (30%)
UAE_UbL 467..552 CDD:291402
UBA2_C 573..691 CDD:292812
mocs3NP_956421.1 PRK07411 46..459 CDD:180967 43/149 (29%)
ThiF_MoeB_HesA_family 62..290 CDD:238386 43/149 (29%)
RHOD_ThiF 327..459 CDD:238784
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.