DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba2 and Atg7

DIOPT Version :9

Sequence 1:NP_524756.2 Gene:Uba2 / 44496 FlyBaseID:FBgn0029113 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_611350.1 Gene:Atg7 / 37141 FlyBaseID:FBgn0034366 Length:684 Species:Drosophila melanogaster


Alignment Length:230 Identity:55/230 - (23%)
Similarity:91/230 - (39%) Gaps:63/230 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ELVKKSKVLVVGAGGIGCEVLKNLVLSGFTDIEIIDLDTIDLSNLNRQFLF-HREHV--GKSKAR 76
            |::.::|.|:.|||.:||.|.:||:..||..|.::|...:..||..||.|: |.:.|  .:.||.
  Fly   335 EIISQTKCLLFGAGTLGCAVARNLLSWGFKHITLLDSGKVGFSNPVRQNLYTHADAVAGNRMKAT 399

  Fly    77 VARESALSFNPDAKITAY------------HDSVTSTDYGVNFFKKF----DLVLSALDNRAAR- 124
            .|.:.....||.|:...|            ...:..|...:...:|.    |::....|:|.:| 
  Fly   400 TAAQRLKEINPSAETAGYVLEIPMPGHTIGESLLAQTKEHLKVIEKLVQDHDVIFLLTDSRESRW 464

  Fly   125 ------NHVNRMCLNADVP-----LIESGT----AGYNGQ-VELIKRGLTQCYECTPKDKQRSFP 173
                  ....::.:||.:.     ::..||    ||.:|| :|.:|        |...|:.    
  Fly   465 LPTLLGAAKEKIVINAALGFDSYLVMRHGTTRKEAGDDGQEIEGLK--------CINGDQL---- 517

  Fly   174 GCTIRNTPSEPIHCIVWAKHLFNQLFGESLEDEDI 208
            ||...|..:.|               |.||:|..:
  Fly   518 GCYFCNDVTAP---------------GNSLKDRTL 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba2NP_524756.2 ThiF 7..>177 CDD:279270 49/197 (25%)
Uba2_SUMO 21..459 CDD:238766 54/224 (24%)
UAE_UbL 467..552 CDD:291402
UBA2_C 573..691 CDD:292812
Atg7NP_611350.1 ATG7_N 9..303 CDD:293029
E1_like_apg7 11..682 CDD:273590 55/230 (24%)
Apg7 341..658 CDD:238763 54/224 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446857
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10953
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.