DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba2 and Uba5

DIOPT Version :9

Sequence 1:NP_524756.2 Gene:Uba2 / 44496 FlyBaseID:FBgn0029113 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_572722.2 Gene:Uba5 / 32094 FlyBaseID:FBgn0030305 Length:404 Species:Drosophila melanogaster


Alignment Length:322 Identity:71/322 - (22%)
Similarity:120/322 - (37%) Gaps:89/322 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ELVKKSKVLVVGAGGIGCEVLKNLVLSGFTDIEIIDLDTIDLSNLNRQFLFHREHVGKSKARVAR 79
            |.::...|.:||.||:|......|...|...:.:.|.|.::|:|:||.| |..:..|.||...|.
  Fly    69 ERIRYKAVAIVGVGGVGSVTADMLTRCGIGKLILFDYDKVELANMNRLF-FTPDQAGLSKVAAAA 132

  Fly    80 ESALSFNPDAKITAYHDSVTSTDYGVNFFKKF---------------DLVLSALDNRAARNHVNR 129
            .:....|||.:|..::.::|:    |..|.:|               |||||.:||..||..:|.
  Fly   133 ATLSFINPDVEIETHNYNITT----VENFDRFLDTISQGGRIAGQPVDLVLSCVDNFEARMAINA 193

  Fly   130 MCLNADVPLIESGTA--GYNGQVELIKRGLTQCYECTP----------KDKQRS----------- 171
            .|...::...|||.:  ..:|.::.|:.|.|.|:.|.|          |..:|.           
  Fly   194 ACNERNLNWFESGVSENAVSGHIQFIRPGDTACFACAPPLVVAENIDEKTLKREGVCAASLPTTM 258

  Fly   172 ---------------------------------FPGCTIRNTPS-EPIHCIVWAKHLFNQLFGES 202
                                             ||..|::..|. :..:|:|..|....:.....
  Fly   259 GITAGFLVQNALKYLLNFGEVSDYLGYNALSDFFPKMTLKPNPQCDDRNCLVRQKEFQARPKPVL 323

  Fly   203 LEDEDISPDAADP------DAKEKDGGDGNGEP-----KGDGKEKGEESKEE-KEAKEDTAN 252
            :|::.:|.:....      :...:|..:.|..|     .|:|.....|:.|: .|..|:|.:
  Fly   324 IEEKAVSEEPLHATNEWGIELVAEDAPESNTTPAETPVMGEGLRLAYEAPEKSSETSEETVS 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba2NP_524756.2 ThiF 7..>177 CDD:279270 54/232 (23%)
Uba2_SUMO 21..459 CDD:238766 70/316 (22%)
UAE_UbL 467..552 CDD:291402
UBA2_C 573..691 CDD:292812
Uba5NP_572722.2 ThiF_MoeB_HesA_family 52..297 CDD:238386 54/232 (23%)
ThiF 53..310 CDD:279270 57/245 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446838
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10953
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.