DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba2 and Uba1

DIOPT Version :9

Sequence 1:NP_524756.2 Gene:Uba2 / 44496 FlyBaseID:FBgn0029113 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_001014102.1 Gene:Uba1 / 314432 RGDID:1359327 Length:1058 Species:Rattus norvegicus


Alignment Length:471 Identity:137/471 - (29%)
Similarity:215/471 - (45%) Gaps:70/471 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VFPPTLQELVKKSKVLVVGAGGIGCEVLKNLVLSGF-----TDIEIIDLDTIDLSNLNRQFLFHR 67
            ||...|||.:.|.|..:||||.||||:|||..:.|.     .::.:.|:|||:.|||||||||..
  Rat   457 VFGSDLQEKLGKQKYFLVGAGAIGCELLKNFAMIGLGCGEGGEVVVTDMDTIEKSNLNRQFLFRP 521

  Fly    68 EHVGKSKARVARESALSFNPDAKITAYHDSV---TSTDYGVNFFKKFDLVLSALDNRAARNHVNR 129
            ..|.|.|:..|..:....||..::|::.:.|   |...|..:||:..|.|.:||||..||.:::|
  Rat   522 WDVTKLKSDTAAAAVRQMNPYIQVTSHQNRVGPDTERIYDDDFFQNLDGVANALDNVDARMYMDR 586

  Fly   130 MCLNADVPLIESGTAGYNGQVELIKRGLTQCYECTPKDKQRSFPGCTIRNTPSEPIHCIVWAKHL 194
            .|:....||:||||.|..|.|:::...||:.|..:....::|.|.||::|.|:...|.:.||:..
  Rat   587 RCVYYRKPLLESGTLGTKGNVQVVIPFLTESYSSSQDPPEKSIPICTLKNFPNAIEHTLQWARDE 651

  Fly   195 FNQLFGESLEDEDISPDAADPDAKEKDGGDGNGEPKGDGKEKGEESKEEKEAKEDTANGNIMRIN 259
            |..||.:..  |:::....|....|:.......:|    .|..|..:.....:.....|:.:...
  Rat   652 FEGLFKQPA--ENVNQYLTDSKFVERTLRLAGTQP----LEVLEAVQRSLVLQRPQTWGDCVTWA 710

  Fly   260 TRQW-AKDCNYDAGKLFNKFFNEDIT----------------------------YLLRMSNLW-- 293
            ...| .:.|| :..:|.:.|..:.:|                            |::..:||:  
  Rat   711 CHHWHTQYCN-NIRQLLHNFPPDQLTSSGAPFWSGPKRCPHPLTFDVNNTLHLDYVMAAANLFAQ 774

  Fly   294 -------KTRKAPVPVQWDTLLPEGSSGDQKDVAKQHHKVWSIEEC-AQVFANSLKELSANFLKL 350
                   :.|.|...:.....:||.:   .|...|.|.....::.. |.|..:.|:||.|.   |
  Rat   775 TYGLTGSQDRAAVASLLQSVQVPEFT---PKSGVKIHVSDQELQSANASVDDSRLEELKAT---L 833

  Fly   351 EGDDTLA--------WDKDDQP--AMDFVAACANVRSHIFDIERKSRFEIKSMAGNIIPAIATTN 405
            ...|.|.        ::|||..  .|||:.|.:|:|:..:||....|.:.|.:||.||||||||.
  Rat   834 PSPDKLPGFKMYPIDFEKDDDSNFHMDFIVAASNLRAENYDISPADRHKSKLIAGKIIPAIATTT 898

  Fly   406 AITAGISVMRAFKVLE 421
            |...|:..:..:||::
  Rat   899 AAVVGLVCLELYKVVQ 914

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba2NP_524756.2 ThiF 7..>177 CDD:279270 69/176 (39%)
Uba2_SUMO 21..459 CDD:238766 131/458 (29%)
UAE_UbL 467..552 CDD:291402
UBA2_C 573..691 CDD:292812
Uba1NP_001014102.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..46
Ube1 49..1055 CDD:273603 137/471 (29%)
2 approximate repeats. /evidence=ECO:0000255 63..611 63/153 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.