DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba2 and Atg7

DIOPT Version :9

Sequence 1:NP_524756.2 Gene:Uba2 / 44496 FlyBaseID:FBgn0029113 Length:700 Species:Drosophila melanogaster
Sequence 2:XP_008761461.1 Gene:Atg7 / 312647 RGDID:1304817 Length:703 Species:Rattus norvegicus


Alignment Length:136 Identity:37/136 - (27%)
Similarity:55/136 - (40%) Gaps:22/136 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PTLQ-ELVKKSKVLVVGAGGIGCEVLKNLVLSGFTDIEIIDLDTIDLSNLNRQFLFHREHV---G 71
            |||. :.|...|.|::|||.:||.|.:.|:..|...:..:|...|..||..||.|:..|..   |
  Rat   342 PTLDLDKVVSVKCLLLGAGTLGCNVARTLMGWGVRHVTFVDNAKISYSNPVRQPLYEFEDCLGGG 406

  Fly    72 KSKARVARESALSFNPDAKITAYHDSVTSTDYGVNF------------------FKKFDLVLSAL 118
            |.||..|.|......|....:.::.|:....:.|||                  ....|::...:
  Rat   407 KPKALAAAERLQKIFPGVNASGFNMSIPMPGHPVNFSDVTMEQARRDVEQLEELIDSHDVIFLLM 471

  Fly   119 DNRAAR 124
            |.|.:|
  Rat   472 DTRESR 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba2NP_524756.2 ThiF 7..>177 CDD:279270 37/136 (27%)
Uba2_SUMO 21..459 CDD:238766 33/125 (26%)
UAE_UbL 467..552 CDD:291402
UBA2_C 573..691 CDD:292812
Atg7XP_008761461.1 ATG7_N 9..316 CDD:293029
E1_like_apg7 11..688 CDD:273590 37/136 (27%)
Apg7 353..677 CDD:238763 33/125 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.