DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba2 and Mocs3

DIOPT Version :9

Sequence 1:NP_524756.2 Gene:Uba2 / 44496 FlyBaseID:FBgn0029113 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_001101274.1 Gene:Mocs3 / 311655 RGDID:1307044 Length:458 Species:Rattus norvegicus


Alignment Length:358 Identity:80/358 - (22%)
Similarity:127/358 - (35%) Gaps:75/358 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SKVLVVGAGGIGCEVLKNLVLSGFTDIEIIDLDTIDLSNLNRQFLFHREHVGKSKARVARESALS 84
            :.|||||.||:||.:.:.|..:|...:.::|.|.::.|||.||.|......|.:||..|..:...
  Rat    81 ASVLVVGCGGLGCPLAQYLAAAGVGRLGLVDHDVVETSNLARQVLHGEAQAGHAKAWSAAAALRR 145

  Fly    85 FNPDAKITAYHDSVTSTDYGVNFFKKFDLVLSALDNRAARNHVNRMCLNADVPLIESGTAGYNGQ 149
            .|...:...|..:: |..:.::..:.:|:|....||...|..||..|:.|..||:.:....:.||
  Rat   146 LNSAVEYVPYARAL-SEAWALDLVRGYDVVADCSDNVPTRYLVNDACVLAGRPLVSASALRFEGQ 209

  Fly   150 VELIKRGLTQCYECTPKDKQRSFPGCTIRNTPSEPI-HCIVWAKHLFNQLFGESLEDEDISPDAA 213
            :.:.......||.|.       ||    |..|:|.: :|                          
  Rat   210 MTVYHYDDGPCYRCV-------FP----RPPPAETVTNC-------------------------- 237

  Fly   214 DPDAKEKDGGDGNGEPKGDGKEKGEESKEEKEAKEDTANGNIM----------RINTRQWAKDC- 267
                  .|||.....|...|..:..|..:.......|.:|:::          ||..|:...|| 
  Rat   238 ------ADGGVLGVVPGVLGCVQALEVLKIAAGLGTTYSGSMLLFDGLGGHFRRIRLRRRRPDCV 296

  Fly   268 ------------NYDAGKLFNKFFNEDITYLLRMSNLWKTRKAPVPVQWDTLLPEGSSGDQKDVA 320
                        ||:|      |.....|...|...|....:......:..||..|......||.
  Rat   297 VCGQQPTVTCLKNYEA------FCGSSATDKCRSLKLLSPEERISVTDYKRLLDSGVPHVLLDVR 355

  Fly   321 KQ-HHKVWSIEECAQVFANSLKELSANFLKLEG 352
            .| ...:..::....:..:.|:...|:.|||.|
  Rat   356 PQVEVDICRLQHSLHIPLSLLERRDADSLKLLG 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba2NP_524756.2 ThiF 7..>177 CDD:279270 44/156 (28%)
Uba2_SUMO 21..459 CDD:238766 80/357 (22%)
UAE_UbL 467..552 CDD:291402
UBA2_C 573..691 CDD:292812
Mocs3NP_001101274.1 PRK07411 53..458 CDD:180967 80/358 (22%)
ThiF_MoeB_HesA_family 60..283 CDD:238386 56/245 (23%)
RHOD_ThiF 325..458 CDD:238784 13/64 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.