DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba2 and Sae1

DIOPT Version :9

Sequence 1:NP_524756.2 Gene:Uba2 / 44496 FlyBaseID:FBgn0029113 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_001012063.1 Gene:Sae1 / 308384 RGDID:1306098 Length:349 Species:Rattus norvegicus


Alignment Length:137 Identity:39/137 - (28%)
Similarity:70/137 - (51%) Gaps:6/137 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 QELVKKSKVLVVGAGGIGCEVLKNLVLSGFTDIEIIDLDTIDLSNLNRQFLFHREHVGKSKARVA 78
            |:.::.|:||:||..|:|.|:.|||:|:|...:.::|.:.:...:|..|||.....||:::|..:
  Rat    34 QKRLRASRVLIVGMKGLGAEIAKNLILAGVKGLTMLDHEQVSPEDLGAQFLIRTGSVGQNRAEAS 98

  Fly    79 RESALSFNP--DAKITAYHDSVTSTDYGVNFFKKFDLVLSALDNRAARNHVNRMCLNADVPLIES 141
            .|.|.:.||  |.|:    |:........:||.:||.|.....::.....|:::|....:.....
  Rat    99 LERAQNLNPMVDVKV----DTEDIEKKPESFFTEFDAVCLTCCSKDVIIKVDQICHRNSIKFFTG 159

  Fly   142 GTAGYNG 148
            ...||:|
  Rat   160 DVFGYHG 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba2NP_524756.2 ThiF 7..>177 CDD:279270 39/137 (28%)
Uba2_SUMO 21..459 CDD:238766 37/130 (28%)
UAE_UbL 467..552 CDD:291402
UBA2_C 573..691 CDD:292812
Sae1NP_001012063.1 Aos1_SUMO 19..344 CDD:238769 39/137 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.