DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba2 and MOCS3

DIOPT Version :9

Sequence 1:NP_524756.2 Gene:Uba2 / 44496 FlyBaseID:FBgn0029113 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_055299.1 Gene:MOCS3 / 27304 HGNCID:15765 Length:460 Species:Homo sapiens


Alignment Length:164 Identity:46/164 - (28%)
Similarity:77/164 - (46%) Gaps:12/164 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 VLVVGAGGIGCEVLKNLVLSGFTDIEIIDLDTIDLSNLNRQFLFHREHVGKSKARVARESALSFN 86
            ||:||.||:||.:.:.|..:|...:.::|.|.:::|||.||.|......|::||..|..|....|
Human    85 VLIVGCGGLGCPLAQYLAAAGVGRLGLVDYDVVEMSNLARQVLHGEALAGQAKAFSAAASLRRLN 149

  Fly    87 PDAKITAYHDSVTSTDYGVNFFKKFDLVLSALDNRAARNHVNRMCLNADVPLIESGTAGYNGQVE 151
            ...:...|..::|... .::..:::|:|....||...|..||..|:.|..||:.:....:.||:.
Human   150 SAVECVPYTQALTPAT-ALDLVRRYDVVADCSDNVPTRYLVNDACVLAGRPLVSASALRFEGQIT 213

  Fly   152 LIKRGLTQCYECTPKDKQRSFPGCTIRNTPSEPI 185
            :.......||.|.       ||    :..|:|.:
Human   214 VYHYDGGPCYRCI-------FP----QPPPAETV 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba2NP_524756.2 ThiF 7..>177 CDD:279270 44/154 (29%)
Uba2_SUMO 21..459 CDD:238766 46/164 (28%)
UAE_UbL 467..552 CDD:291402
UBA2_C 573..691 CDD:292812
MOCS3NP_055299.1 ThiF_MoeB_HesA_family 62..285 CDD:238386 46/164 (28%)
RHOD_ThiF 327..460 CDD:238784
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.