DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba2 and Uba1

DIOPT Version :9

Sequence 1:NP_524756.2 Gene:Uba2 / 44496 FlyBaseID:FBgn0029113 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_033483.2 Gene:Uba1 / 22201 MGIID:98890 Length:1118 Species:Mus musculus


Alignment Length:471 Identity:136/471 - (28%)
Similarity:214/471 - (45%) Gaps:70/471 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VFPPTLQELVKKSKVLVVGAGGIGCEVLKNLVLSGF-----TDIEIIDLDTIDLSNLNRQFLFHR 67
            ||....||.:.|.|..:||||.||||:|||..:.|.     .::.:.|:|||:.|||||||||..
Mouse   517 VFGSDFQEKLSKQKYFLVGAGAIGCELLKNFAMIGLGCGEGGEVVVTDMDTIEKSNLNRQFLFRP 581

  Fly    68 EHVGKSKARVARESALSFNPDAKITAYHDSV---TSTDYGVNFFKKFDLVLSALDNRAARNHVNR 129
            ..|.|.|:..|..:....||..::|::.:.|   |...|..:||:..|.|.:||||..||.:::|
Mouse   582 WDVTKLKSDTAAAAVRQMNPYIQVTSHQNRVGPDTERIYDDDFFQNLDGVANALDNIDARMYMDR 646

  Fly   130 MCLNADVPLIESGTAGYNGQVELIKRGLTQCYECTPKDKQRSFPGCTIRNTPSEPIHCIVWAKHL 194
            .|:....||:||||.|..|.|:::...||:.|..:....::|.|.||::|.|:...|.:.||:..
Mouse   647 RCVYYRKPLLESGTLGTKGNVQVVIPFLTESYSSSQDPPEKSIPICTLKNFPNAIEHTLQWARDE 711

  Fly   195 FNQLFGESLEDEDISPDAADPDAKEKDGGDGNGEPKGDGKEKGEESKEEKEAKEDTANGNIMRIN 259
            |..||.:..  |:::....|....|:.......:|    .|..|..:.....:.....|:.:...
Mouse   712 FEGLFKQPA--ENVNQYLTDSKFVERTLRLAGTQP----LEVLEAVQRSLVLQRPQTWGDCVTWA 770

  Fly   260 TRQW-AKDCNYDAGKLFNKFFNEDIT----------------------------YLLRMSNLW-- 293
            ...| .:.|| :..:|.:.|..:.:|                            |::..:||:  
Mouse   771 CHHWHTQYCN-NIRQLLHNFPPDQLTSSGAPFWSGPKRCPHPLTFDVNNTLHLDYVMAAANLFAQ 834

  Fly   294 -------KTRKAPVPVQWDTLLPEGSSGDQKDVAKQHHKVWSIEEC-AQVFANSLKELSANFLKL 350
                   :.|.|...:.....:||.:   .|...|.|.....::.. |.|..:.|:||.|.   |
Mouse   835 TYGLTGSQDRAAVASLLQSVQVPEFT---PKSGVKIHVSDQELQSANASVDDSRLEELKAT---L 893

  Fly   351 EGDDTLA--------WDKDDQP--AMDFVAACANVRSHIFDIERKSRFEIKSMAGNIIPAIATTN 405
            ...|.|.        ::|||..  .|||:.|.:|:|:..:||....|.:.|.:||.||||||||.
Mouse   894 PSPDKLPGFKMYPIDFEKDDDSNFHMDFIVAASNLRAENYDISPADRHKSKLIAGKIIPAIATTT 958

  Fly   406 AITAGISVMRAFKVLE 421
            |...|:..:..:||::
Mouse   959 AAVVGLVCLELYKVVQ 974

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba2NP_524756.2 ThiF 7..>177 CDD:279270 68/176 (39%)
Uba2_SUMO 21..459 CDD:238766 131/458 (29%)
UAE_UbL 467..552 CDD:291402
UBA2_C 573..691 CDD:292812
Uba1NP_033483.2 ThiF 109..1115 CDD:330201 136/471 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.