DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba2 and atg-7

DIOPT Version :9

Sequence 1:NP_524756.2 Gene:Uba2 / 44496 FlyBaseID:FBgn0029113 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_502064.1 Gene:atg-7 / 178005 WormBaseID:WBGene00010882 Length:647 Species:Caenorhabditis elegans


Alignment Length:133 Identity:38/133 - (28%)
Similarity:61/133 - (45%) Gaps:19/133 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PTLQ-ELVKKSKVLVVGAGGIGCEVLKNLVLSGFTDIEIIDLDTIDLSNLNRQFL--FHREHVGK 72
            |.:| |...:.|||::|||.:||.:.:.|:..|...|..:|..|:..:|..||.|  |....:|:
 Worm   315 PDIQLERYSQLKVLILGAGTLGCNIARCLIGWGVRHISFLDNSTVSYNNPVRQSLSEFEDARLGR 379

  Fly    73 SKARVARESALSFNPDAKITAYHDSVTSTDYGVN----------------FFKKFDLVLSALDNR 121
            .||..|:.:.....|..:.||:..:|....:.::                ..|..|:|..|||:|
 Worm   380 GKAETAQAAIQRIFPSIQATAHRLTVPMPGHSIDEKDVPELEKDIAKLEQLVKDHDVVFLALDSR 444

  Fly   122 AAR 124
            .||
 Worm   445 EAR 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba2NP_524756.2 ThiF 7..>177 CDD:279270 38/133 (29%)
Uba2_SUMO 21..459 CDD:238766 35/122 (29%)
UAE_UbL 467..552 CDD:291402
UBA2_C 573..691 CDD:292812
atg-7NP_502064.1 E1_like_apg7 4..635 CDD:273590 38/133 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.