DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GluRIB and Ir92a

DIOPT Version :9

Sequence 1:NP_001261621.2 Gene:GluRIB / 44484 FlyBaseID:FBgn0264000 Length:1182 Species:Drosophila melanogaster
Sequence 2:NP_001097845.2 Gene:Ir92a / 42415 FlyBaseID:FBgn0038789 Length:678 Species:Drosophila melanogaster


Alignment Length:559 Identity:103/559 - (18%)
Similarity:182/559 - (32%) Gaps:169/559 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   483 AKYVRLRPHVEFE-KNRTYIVTTVLEEPYIMLKQVAFG----EKLHGN--NR---FEG------- 530
            |..|.|.|:.... :.|:.:|.::...||.:...|..|    :.:|..  ||   |:|       
  Fly   229 ANRVELYPNKLLNLQRRSLLVGSITYVPYTITNYVPAGQGDVDPIHPQWPNRSLTFDGAEANVMK 293

  Fly   531 -YCKDLADLLAKELGINYELRLVK------DGNYGSEKSSAHGGWDGMVGELVRKEADIAIAAMT 588
             :|:          ..|..||:..      .|.|.:|.|      |||:|::..:..::||..  
  Fly   294 TFCQ----------VHNCHLRVEAYGADNWGGIYDNESS------DGMLGDIYEQRVEMAIGC-- 340

  Fly   589 ITAERERVIDFSKPFMSLGISIMIKKPVKQTPGVFSFMNPLSQEIWVSVIFSYIGVSIVLFFVSR 653
            |....:.:.:.|.......::|:...|. ..|...:.:.|.:...|:.:|.:.:.....|:|:..
  Fly   341 IYNWYDGITETSHTIARSSVTILGPAPA-PLPSWRTNIMPFNNRAWLVLISTLVICGTFLYFMKY 404

  Fly   654 FSPHEWRLVQQQPQQSQSPDPHAHHEQLANQQPPGIIGGAPLPAPPGPPTPGAQTAAGAAALQAA 718
            .|   :||.....|..      .||.:..                                    
  Fly   405 VS---YRLRYSGTQVK------FHHSRKL------------------------------------ 424

  Fly   719 LSAGSPGSGGSSSAVVNEFSVWNSFWFSLAAFMQQ-GCDLSPRSVSGRIAAASWFFFTLILISSY 782
                             |.|:.:.|    |.|:|| ...||....:.|...|:....|:.|.:.|
  Fly   425 -----------------EKSMLDIF----ALFIQQPSAPLSFDRFAPRFFLATILCATITLENIY 468

  Fly   783 TANLAAFLTVERMVTPINSPEDLAMQTEVQYGTLLHGSTWDFFRRSQIGLHN------------- 834
            :..|.:.||......|:::.|..|.            |.|.:...|.|.:|.             
  Fly   469 SGQLKSMLTFPFYSAPVDTIEKWAQ------------SGWKWSAPSIIWVHTVQSSDLETEQILA 521

  Fly   835 ---KMWEYMNSRKHVFVPTYDEGIKRVRNSKGKYALLVESPKNEYVNAREPCDTMKVGRNL---D 893
               ::.:|.......|:|.|..||:|:  |.|..::      .:||:.....:.:.:..:|   .
  Fly   522 RNFEVHDYSYLSNVSFMPNYGFGIERL--SSGSLSV------GDYVSTEALENRIVLHDDLYFDY 578

  Fly   894 TKGFGIATPLGSALKDPINLAVLTLKENGELIKLRNKW-------WYEKAECSTHKDGETSH--- 948
            |:...|.   |..|...:|..:.|.:|.|    |...|       :.:|.:.....|....|   
  Fly   579 TRAVSIR---GWILMPELNKHIRTCQETG----LYFHWELEFIDKYMDKKKQEVLMDLANGHKVK 636

  Fly   949 ---SELSLSNVAGIFYILIGGLLVSVFVAILEYCFRSRD 984
               ..|.:.|:||..::|..|:..:....:.|......|
  Fly   637 GAPQALDVRNIAGALFVLAFGVAFAGCALVAELLIHRMD 675

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GluRIBNP_001261621.2 PBP1_iGluR_AMPA 43..478 CDD:107375
ANF_receptor 55..461 CDD:279440
PBP2_iGluR_AMPA 497..938 CDD:270433 89/490 (18%)
Lig_chan 632..967 CDD:278489 65/367 (18%)
Ir92aNP_001097845.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462549
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.