DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GluRIB and Ir85a

DIOPT Version :9

Sequence 1:NP_001261621.2 Gene:GluRIB / 44484 FlyBaseID:FBgn0264000 Length:1182 Species:Drosophila melanogaster
Sequence 2:NP_649833.1 Gene:Ir85a / 41052 FlyBaseID:FBgn0037630 Length:605 Species:Drosophila melanogaster


Alignment Length:146 Identity:31/146 - (21%)
Similarity:59/146 - (40%) Gaps:32/146 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   759 PRSVSGRIAAASWFFFTLILISSYTANLAAFLTVERMVTPINSPEDLAMQTEVQYGTLL------ 817
            |.:.|.|:....|.:|.|::.|::..||.:.:..:..:..||....||..   .|..::      
  Fly   366 PPNHSIRLFLIFWLYFGLLICSAFKGNLTSMMVFQPYLPDINQLGALARS---HYHIIIRPRHVK 427

  Fly   818 ---HGSTWDFFRRSQIGLHNKMWEYMNSRKHVFVPTYDEGIKRVRNSKGKYALLVESPKNEYVNA 879
               |..|......|:|  ..:|.|..:::.:          :.:||:..::|.|     .:|..|
  Fly   428 HIQHFLTLGHKHESRI--REQMLEVSDTQMY----------EMMRNNDIRFAYL-----EKYHIA 475

  Fly   880 REPCDT---MKVGRNL 892
            |...::   |.:||.|
  Fly   476 RFQVNSRVHMHLGRPL 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GluRIBNP_001261621.2 PBP1_iGluR_AMPA 43..478 CDD:107375
ANF_receptor 55..461 CDD:279440
PBP2_iGluR_AMPA 497..938 CDD:270433 31/146 (21%)
Lig_chan 632..967 CDD:278489 31/146 (21%)
Ir85aNP_649833.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462545
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.