DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GluRIB and Ir68b

DIOPT Version :9

Sequence 1:NP_001261621.2 Gene:GluRIB / 44484 FlyBaseID:FBgn0264000 Length:1182 Species:Drosophila melanogaster
Sequence 2:NP_648548.1 Gene:Ir68b / 39378 FlyBaseID:FBgn0036250 Length:635 Species:Drosophila melanogaster


Alignment Length:287 Identity:58/287 - (20%)
Similarity:97/287 - (33%) Gaps:90/287 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 LNVSSRRFELQAYVDVINTADAFKLSRLICNQFSRGVYSMLGAVSPDSFDTLHSYSNTFQM-PFV 131
            ||...||..:..|:.|...|...:|.||....:::.:...|.....:        :.||.. ||.
  Fly   109 LNPHQRRKHMHKYLFVWPNAGRHQLLRLFRGSWAKKLLYGLAITGRE--------NGTFDFDPFA 165

  Fly   132 TPWFPEKVLTPSSGFLDFALSMRPDYHQAIIDTIQFYGWRKIIYLYDSHDGLLRLQQI------Y 190
              |...:|:....|.:.:|..::         .::.|..|..::.    |.|:.:.:.      |
  Fly   166 --WGGLQVIQRLDGEVPYARKVK---------DLRGYPLRFSMFT----DPLMAMPRSPVETAGY 215

  Fly   191 QGLRPGNESFQVELVKRISNVSMAIEFLHTLEQIGR---------------------FENKHIVL 234
            |.:    :.....:|..:.|.|:...|....|..||                     ..|...||
  Fly   216 QAV----DGVAARVVGEMLNASVTYVFPEDNESYGRCLPNGNYTGVVSDIVGGHTHFAPNSRFVL 276

  Fly   235 DC--PTEMAKQILIQHVRD------------------LRLGRRTYHYLL--SGLVMDDRWESEII 277
            ||  |   |.::|..:.|.                  :|:.|||..|||  :.||:       ::
  Fly   277 DCIWP---AVEVLYPYTRRNLHLVVPASAIQPEYLIFVRVFRRTVWYLLLVTLLVV-------VL 331

  Fly   278 EFGAINITGFRIVDTNRRLVREFYDSW 304
            .|..:.....||   .||.|.:|..:|
  Fly   332 VFWVMQRLQRRI---PRRGVIQFQATW 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GluRIBNP_001261621.2 PBP1_iGluR_AMPA 43..478 CDD:107375 58/287 (20%)
ANF_receptor 55..461 CDD:279440 58/287 (20%)
PBP2_iGluR_AMPA 497..938 CDD:270433
Lig_chan 632..967 CDD:278489
Ir68bNP_648548.1 Lig_chan 333..607 CDD:278489 8/26 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462576
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.