DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GluRIB and Ir7a

DIOPT Version :9

Sequence 1:NP_001261621.2 Gene:GluRIB / 44484 FlyBaseID:FBgn0264000 Length:1182 Species:Drosophila melanogaster
Sequence 2:NP_572406.1 Gene:Ir7a / 31686 FlyBaseID:FBgn0029961 Length:614 Species:Drosophila melanogaster


Alignment Length:437 Identity:74/437 - (16%)
Similarity:133/437 - (30%) Gaps:151/437 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   570 GMVGELVRKEADIAIAAMTITAERERVIDFSKPFMSLGISIMIKKPVKQTPGVFSFMNPLSQEIW 634
            |...:::...:.|.|.||:.:.:......|:..:....: :.|.....|...|.....|.:..:|
  Fly   286 GCFDQVIISNSSILIGAMSGSHQHRSHFSFTSSYHQSSL-VFIMHMSSQFGAVAQLAVPFTVIVW 349

  Fly   635 VSVIFSYIGVSIVLFFVSRFSPHEWRLVQQQPQQSQSPDPHAHHEQLANQQPPGIIGGAPLPAPP 699
            ::::.|.:.:.:||:..:|.                                  :.|.:.|    
  Fly   350 LALVVSSLLLVLVLWMRNRL----------------------------------VCGRSDL---- 376

  Fly   700 GPPTPGAQTAAGAAALQAALS-AGSPGSGGSSSAVVNEFSVWNSFWFSLAAFMQQGCDLSPRSVS 763
                       .:.|||...: .|:|....|                            .|||..
  Fly   377 -----------ASHALQVLTTLMGNPLEARS----------------------------LPRSSR 402

  Fly   764 GRIAAASWFFFTLILISSYTANLAAFLTVERMVTPINSPEDLAMQTEV------QYGTLLHGSTW 822
            .||..|.|....|:|...|...|     .:....|.:.|    :.||:      .| ||::....
  Fly   403 LRILYAGWLLLVLVLRVVYQGKL-----FDSFRLPYHKP----LPTEISELIRSNY-TLINQEYL 457

  Fly   823 DFFRRSQIGLHNKMWEYMNSRKHVFVPTYDEGIKRVRNSKGKYALLVESPKNEYVNAREPCDTMK 887
            |::.|....|..      |..|..|  .|.:|:    ..:||:.........||.|...      
  Fly   458 DYYPRELTVLTR------NGSKDRF--DYIQGL----GKEGKFTTTSLIATMEYYNMMH------ 504

  Fly   888 VGRNLDTKGFGIATPLGSALKDPINL--AVLTLKENGELIKLRNKWWYEKA-------------- 936
                       .:|...:.:|:.|.|  .|:.|:.:..|     |:.:::.              
  Fly   505 -----------WSTSRLTHIKEHIFLYQMVIYLRRHSLL-----KFAFDRKIKQLLSAGIIGYFV 553

  Fly   937 ----ECSTHKDGETSH--SELSLSNVAGIFYILIGGLLVSVFVAILE 977
                .|...|..|..:  :.:.|.:..|::||.:..|..:|...|||
  Fly   554 REFDACQYRKPFEEDYEVTPIPLDSFCGLYYISLIWLSAAVVAFILE 600

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GluRIBNP_001261621.2 PBP1_iGluR_AMPA 43..478 CDD:107375
ANF_receptor 55..461 CDD:279440
PBP2_iGluR_AMPA 497..938 CDD:270433 62/394 (16%)
Lig_chan 632..967 CDD:278489 59/363 (16%)
Ir7aNP_572406.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.