DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GluRIB and ZK867.2

DIOPT Version :9

Sequence 1:NP_001261621.2 Gene:GluRIB / 44484 FlyBaseID:FBgn0264000 Length:1182 Species:Drosophila melanogaster
Sequence 2:NP_001355384.1 Gene:ZK867.2 / 191445 WormBaseID:WBGene00022829 Length:354 Species:Caenorhabditis elegans


Alignment Length:133 Identity:34/133 - (25%)
Similarity:60/133 - (45%) Gaps:33/133 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   532 CK------DLADLLAKELGINYEL-----RLVKDGNYGSEKSSAHGGWDGMVGELVRKEADIAIA 585
            ||      ::..::.:.:|:||.:     :..:..::||::.  :|.|.||:|.|...:.|:...
 Worm    24 CKHPGAEVEILKMIFRLIGVNYTMIDVWKKFGQQYDFGSKQK--NGNWSGMIGLLQSDQLDMIGL 86

  Fly   586 AMTITAERERVIDFSKPFMSLGISIMIKKPVKQTPGVFSFMNPLSQEIWVSVIFSYIGVSIVLFF 650
            :|.|..|||.|:.||.|......||.            ||  |:|..:.:.:|.      |..||
 Worm    87 SMRIAPEREEVVLFSYPTRVFETSIQ------------SF--PVSSRMLLLIIL------IATFF 131

  Fly   651 VSR 653
            :|:
 Worm   132 ISQ 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GluRIBNP_001261621.2 PBP1_iGluR_AMPA 43..478 CDD:107375
ANF_receptor 55..461 CDD:279440
PBP2_iGluR_AMPA 497..938 CDD:270433 34/133 (26%)
Lig_chan 632..967 CDD:278489 5/22 (23%)
ZK867.2NP_001355384.1 Lig_chan-Glu_bd 22..77 CDD:214911 12/54 (22%)
Periplasmic_Binding_Protein_Type_2 <69..>103 CDD:389745 14/33 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.