DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Met75Ca and Met75Cb

DIOPT Version :10

Sequence 1:NP_730336.1 Gene:Met75Ca / 44482 FlyBaseID:FBgn0028416 Length:51 Species:Drosophila melanogaster
Sequence 2:NP_651980.1 Gene:Met75Cb / 44481 FlyBaseID:FBgn0028415 Length:51 Species:Drosophila melanogaster


Alignment Length:51 Identity:51/51 - (100%)
Similarity:51/51 - (100%) Gaps:0/51 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNVFNGFLLVFLGLALSSVDAQIATRQETSEDKACGPHAYYNYARHTCLPF 51
            |||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly     1 MNVFNGFLLVFLGLALSSVDAQIATRQETSEDKACGPHAYYNYARHTCLPF 51

Return to query results.
Submit another query.