powered by:
Protein Alignment Met75Cb and Met75Ca
DIOPT Version :9
Sequence 1: | NP_651980.1 |
Gene: | Met75Cb / 44481 |
FlyBaseID: | FBgn0028415 |
Length: | 51 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_730336.1 |
Gene: | Met75Ca / 44482 |
FlyBaseID: | FBgn0028416 |
Length: | 51 |
Species: | Drosophila melanogaster |
Alignment Length: | 51 |
Identity: | 51/51 - (100%) |
Similarity: | 51/51 - (100%) |
Gaps: | 0/51 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MNVFNGFLLVFLGLALSSVDAQIATRQETSEDKACGPHAYYNYARHTCLPF 51
|||||||||||||||||||||||||||||||||||||||||||||||||||
Fly 1 MNVFNGFLLVFLGLALSSVDAQIATRQETSEDKACGPHAYYNYARHTCLPF 51
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45452761 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.