DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Met75Cb and Met75Ca

DIOPT Version :9

Sequence 1:NP_651980.1 Gene:Met75Cb / 44481 FlyBaseID:FBgn0028415 Length:51 Species:Drosophila melanogaster
Sequence 2:NP_730336.1 Gene:Met75Ca / 44482 FlyBaseID:FBgn0028416 Length:51 Species:Drosophila melanogaster


Alignment Length:51 Identity:51/51 - (100%)
Similarity:51/51 - (100%) Gaps:0/51 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNVFNGFLLVFLGLALSSVDAQIATRQETSEDKACGPHAYYNYARHTCLPF 51
            |||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly     1 MNVFNGFLLVFLGLALSSVDAQIATRQETSEDKACGPHAYYNYARHTCLPF 51



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452761
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.