DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ear and TAF14

DIOPT Version :9

Sequence 1:NP_001262595.1 Gene:ear / 44451 FlyBaseID:FBgn0026441 Length:945 Species:Drosophila melanogaster
Sequence 2:NP_015196.1 Gene:TAF14 / 855974 SGDID:S000006050 Length:244 Species:Saccharomyces cerevisiae


Alignment Length:196 Identity:41/196 - (20%)
Similarity:81/196 - (41%) Gaps:31/196 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 W--EIYVQGVNKADISAFV-EKVVFVLHESFPKPKRVVKEPPYAIQESGYAGFLLPVEIYFRNRD 91
            |  ||.:......:|.|.: :||::.||.:|..|.|...:||:.|:|.|:.||.|.:.::...:.
Yeast    32 WSIEIVLLDDEGKEIPATIFDKVIYHLHPTFANPNRTFTDPPFRIEEQGWGGFPLDISVFLLEKA 96

  Fly    92 EPKRIVYQYDLVLQSTGPPQHHVEVKTHIFEAPSEE--FRTKLMRGGGVPVFGANIGAGSLARTL 154
            ..::|.:..:.:.:|     :.||   |:.:.|..:  ...:|.:.|......||.|.....||.
Yeast    97 GERKIPHDLNFLQES-----YEVE---HVIQIPLNKPLLTEELAKSGSTEETTANTGTIGKRRTT 153

  Fly   155 SPSVGSGETAHSNEMSGVKAKG------------------VPGTISMNSDLNTGKKHKSRSEDPG 201
            :.:....:...:...|....||                  :.|.:.|.:|..|.:.:.:.:.:.|
Yeast   154 TNTTAEPKAKRAKTGSASTVKGSVDLEKLAFGLTKLNEDDLVGVVQMVTDNKTPEMNVTNNVEEG 218

  Fly   202 K 202
            :
Yeast   219 E 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
earNP_001262595.1 YEATS 27..107 CDD:281374 21/79 (27%)
TAF14NP_015196.1 TFG3 2..242 CDD:227366 41/196 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344822
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5033
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23195
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.