DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ear and GAS41

DIOPT Version :9

Sequence 1:NP_001262595.1 Gene:ear / 44451 FlyBaseID:FBgn0026441 Length:945 Species:Drosophila melanogaster
Sequence 2:NP_199373.1 Gene:GAS41 / 834599 AraportID:AT5G45600 Length:268 Species:Arabidopsis thaliana


Alignment Length:277 Identity:66/277 - (23%)
Similarity:113/277 - (40%) Gaps:67/277 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VKVQFEIGHTSKLRSKKTPHPQAFTHDWEIYVQGVNKADISAFVEKVVFVLHESFPKPKRVVKEP 67
            :.|....|:.:....||....|  :|.|.:||:|....|||..|:||||.||.||..|.||::||
plant    44 ISVPIVYGNVAFWLGKKASEYQ--SHKWAVYVRGATNEDISVVVKKVVFQLHSSFNSPTRVIEEP 106

  Fly    68 PYAIQESGYAGFLLPVEIYFRNR--DEPKRIVYQYDLVLQSTGPP---QHHVEVKTH---IFEAP 124
            |:.:.|||:..|.:.:.::|.:.  |:|..:.:...|..:....|   :..|.|:::   :|..|
plant   107 PFEVSESGWGEFEIAMTLHFHSDVCDKPLSLYHHLKLYPEDESGPLTMKKPVVVESYDEIVFPDP 171

  Fly   125 SEEFRTKLMRGGGVPVFGANIGAGSLARTLS------PSVGSGETAHSNEMSGVKAKGVPGTISM 183
            ||.|                     |||..:      |.:.||             ..:|..:.:
plant   172 SESF---------------------LARVQNHPALTFPRLPSG-------------YNLPAPMQV 202

  Fly   184 NSDLNTGKKHKSRSEDPGKSNAFSALFGPPITKTSVTANNMAQVPVSKHSPEAKSAAVGGKGVFH 248
            .   :||||.:..::|......|.:.         ..|:.:.|:..::...:|..|.:..:....
plant   203 E---DTGKKKRGDTKDHSLGQWFMSF---------SEADELLQLAAARQQVQAHIAKLRRQISLL 255

  Fly   249 EGREKASKDRDKSSGGD 265
            ||:.:..|     :|.|
plant   256 EGQNQTVK-----TGSD 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
earNP_001262595.1 YEATS 27..107 CDD:281374 31/81 (38%)
GAS41NP_199373.1 YEATS_TFIID14_like 44..175 CDD:341129 43/132 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5033
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482359at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23195
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.