DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ear and TAF14

DIOPT Version :9

Sequence 1:NP_001262595.1 Gene:ear / 44451 FlyBaseID:FBgn0026441 Length:945 Species:Drosophila melanogaster
Sequence 2:NP_001189547.1 Gene:TAF14 / 816312 AraportID:AT2G18000 Length:268 Species:Arabidopsis thaliana


Alignment Length:158 Identity:42/158 - (26%)
Similarity:72/158 - (45%) Gaps:18/158 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 THDWEIYVQGVNKADISAFVEKVVFVLHESFPKPKRVVKEPPYAIQESGYAGFLLPVEIYFRNRD 91
            ||.|.:||:|....|:...:::|:|.||.||..|.|||..||:|:.|.|:..|.:.:.::|....
plant    62 THKWTVYVRGATNEDLGVVIKRVIFHLHPSFNNPTRVVDAPPFALSECGWGEFKIDITVFFHTDV 126

  Fly    92 EPKRIVYQYDLVL---QSTGPPQHHVEV-------KTHIFEAPSEEFRTKLMRGGGVPVFGANIG 146
            ..|::...:.|.|   .:.||....:::       ...:|..|.|.|..::.....:.:  :||.
plant   127 CEKKLELSHVLKLNPENAYGPIPKSIKIPVVAESYNEVVFPDPFESFVARVHNHPAIQI--SNIP 189

  Fly   147 AG-SLARTLSPSVGSGETAHSNEMSGVK 173
            .| :|     |..|..:|.:..|....|
plant   190 DGLNL-----PPPGVADTYYLMEKGDTK 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
earNP_001262595.1 YEATS 27..107 CDD:281374 27/82 (33%)
TAF14NP_001189547.1 YEATS_TFIID14_like 40..173 CDD:341129 32/110 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5033
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482359at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23195
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.