DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ear and YEATS4

DIOPT Version :9

Sequence 1:NP_001262595.1 Gene:ear / 44451 FlyBaseID:FBgn0026441 Length:945 Species:Drosophila melanogaster
Sequence 2:NP_006521.1 Gene:YEATS4 / 8089 HGNCID:24859 Length:227 Species:Homo sapiens


Alignment Length:195 Identity:51/195 - (26%)
Similarity:82/195 - (42%) Gaps:40/195 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GHTSKLRSKKTPHPQAFTHDWEIYVQGVNKADISAFVEKVVFVLHESFPKPKRVVKEPPYAIQES 74
            |:.::...||. .....||.|.:||:.....|:||:|:|:.|.||||:..|.|||.:|||.|.|:
Human    28 GNVARYFGKKR-EEDGHTHQWTVYVKPYRNEDMSAYVKKIQFKLHESYGNPLRVVTKPPYEITET 91

  Fly    75 GYAGFLLPVEIYFRNRDEPKRIVYQYDLVLQS---------TGPPQHHVEVKTHIFEAPSEEFRT 130
            |:..|.:.::|:|.:.:|....:|....:.||         |...:.:.|:   ||:.|:...:.
Human    92 GWGEFEIIIKIFFIDPNERPVTLYHLLKLFQSDTNAMLGKKTVVSEFYDEM---IFQDPTAMMQQ 153

  Fly   131 KLMRGGGVPVFGANIGAGSLARTLSPSVGSGETAHSNEMSGVKAKGVPGTISMNSDLNTGKKHKS 195
            .|                    |.|..:..|...|..|.:.::.|       ....|...||..|
Human   154 LL--------------------TTSRQLTLGAYKHETEFAELEVK-------TREKLEAAKKKTS 191

  Fly   196  195
            Human   192  191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
earNP_001262595.1 YEATS 27..107 CDD:281374 32/88 (36%)
YEATS4NP_006521.1 YEATS_GAS41_like 19..155 CDD:341128 40/130 (31%)
Diacetylated histone H3 binding. /evidence=ECO:0000269|PubMed:29900004, ECO:0000269|PubMed:30071723, ECO:0007744|PDB:5VNB, ECO:0007744|PDB:5XTZ 93..97 0/3 (0%)
Interaction with MLLT10. /evidence=ECO:0000269|PubMed:11756182 163..227 8/36 (22%)
Interaction with TACC1. /evidence=ECO:0000269|PubMed:11903063 168..227 7/31 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5033
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482359at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.