Sequence 1: | NP_001262595.1 | Gene: | ear / 44451 | FlyBaseID: | FBgn0026441 | Length: | 945 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_080846.1 | Gene: | Yeats4 / 64050 | MGIID: | 1927224 | Length: | 227 | Species: | Mus musculus |
Alignment Length: | 195 | Identity: | 51/195 - (26%) |
---|---|---|---|
Similarity: | 82/195 - (42%) | Gaps: | 40/195 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 GHTSKLRSKKTPHPQAFTHDWEIYVQGVNKADISAFVEKVVFVLHESFPKPKRVVKEPPYAIQES 74
Fly 75 GYAGFLLPVEIYFRNRDEPKRIVYQYDLVLQS---------TGPPQHHVEVKTHIFEAPSEEFRT 130
Fly 131 KLMRGGGVPVFGANIGAGSLARTLSPSVGSGETAHSNEMSGVKAKGVPGTISMNSDLNTGKKHKS 195
Fly 196 195 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ear | NP_001262595.1 | YEATS | 27..107 | CDD:281374 | 32/88 (36%) |
Yeats4 | NP_080846.1 | YEATS_GAS41_like | 19..155 | CDD:341128 | 40/130 (31%) |
Diacetylated histone H3 binding. /evidence=ECO:0000250|UniProtKB:O95619 | 93..97 | 0/3 (0%) | |||
Interaction with MLLT10. /evidence=ECO:0000250 | 163..227 | 8/36 (22%) | |||
Interaction with TACC1. /evidence=ECO:0000250 | 168..227 | 7/31 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5033 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |