DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ear and MLLT1

DIOPT Version :9

Sequence 1:NP_001262595.1 Gene:ear / 44451 FlyBaseID:FBgn0026441 Length:945 Species:Drosophila melanogaster
Sequence 2:XP_011526323.1 Gene:MLLT1 / 4298 HGNCID:7134 Length:600 Species:Homo sapiens


Alignment Length:926 Identity:226/926 - (24%)
Similarity:326/926 - (35%) Gaps:380/926 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VKVQFEIGHTSKLRSKKTPHPQAFTHDWEIYVQGVNKADISAFVEKVVFVLHESFPKPKRVVKEP 67
            |:|:.|:||.::||.|  |..:.|||||.::|:|..:.||..|||||||.||:|||||:||.|||
Human    48 VQVRLELGHRAQLRKK--PTTEGFTHDWMVFVRGPEQCDIQHFVEKVVFWLHDSFPKPRRVCKEP 110

  Fly    68 PYAIQESGYAGFLLPVEIYFRNRDEPKRIVYQYDLVLQSTG-PPQHHVEVKTHIFEAPSEEFRTK 131
            ||.::|||||||::|:|::|:|::||:::.:.|||.|...| ||.:|:..:...|..|:.|||.|
Human   111 PYKVEESGYAGFIMPIEVHFKNKEEPRKVCFTYDLFLNLEGNPPVNHLRCEKLTFNNPTTEFRYK 175

  Fly   132 LMRGGGVPVFGANIGAGSLARTLSPSVGSGETAHSNEMSGVKAKGVPGTISMNSDLNTGKKHKSR 196
            |:|.|||.|...  ||.:::|. ||..                                      
Human   176 LLRAGGVMVMPE--GADTVSRP-SPDY-------------------------------------- 199

  Fly   197 SEDPGKSNAFSALFGPPITKTSVTANNMAQVPVSKHSPEAKSAAVGGKGVFHEGREKASKDRDK- 260
                            |:..|         :|:|..|...|:....|           |||.:| 
Human   200 ----------------PMLPT---------IPLSAFSDPKKTKPSHG-----------SKDANKE 228

  Fly   261 SSGGDKPREKDKKDRHGRDKDRKSSKSGDGKHERDKEKSKKDKSRDKEREREQGSGNTTSANALT 325
            ||...||.:..|:.|....|| ..|||...:.||::.||.||.|      |:.|.|..       
Human   229 SSKTSKPHKVTKEHRERPRKD-SESKSSSKELEREQAKSSKDTS------RKLGEGRL------- 279

  Fly   326 VATSVGTAGGLVKHTASPKPGKPNEMGAPSPKKTANDSAAGAVAPTSRSKERDEHKSVKSESKDK 390
                                  |.|..||.||       |....|....||            .|
Human   280 ----------------------PKEEKAPPPK-------AAFKEPKMALKE------------TK 303

  Fly   391 ERSSSKKSKKDKKDKDKQRDESKDKRMPKDERPGQSDSPASGNLQSAHLQQQSQVASTGKATPTS 455
            ..|:|.|...........|..||        ||..:|||                          
Human   304 LESTSPKGGPPPPPPPPPRASSK--------RPATADSP-------------------------- 334

  Fly   456 VGSNSSSSMVSNIGKQKEEATGKHSEKAAESKGDKSTSNGNATDTKKSHKHKKKEKSKDKEKERN 520
                                                         |.|.|.:||..||       
Human   335 ---------------------------------------------KPSAKKQKKSSSK------- 347

  Fly   521 DRDKDKDKERDKDKLKEREKDKQHVTGSEKSSTVDPSPKLEGASPATEGGAPDKTPVSASASSGS 585
                                      ||.                    .||..:|.::|:||.|
Human   348 --------------------------GSR--------------------SAPGTSPRTSSSSSFS 366

  Fly   586 KKEKHKKSKEKSSGKDEKRQREAVDKQADTKHTGKSQQSQSGQSKTPSNLDLSDMDSAQSAPDLA 650
            .|   |.:|:|||.:.||.:.|:..::|.     |:.:.:...|:..::.   ..:||||:|..:
Human   367 DK---KPAKDKSSTRGEKVKAESEPREAK-----KALEVEESNSEDEASF---KSESAQSSPSNS 420

  Fly   651 ATNALAAAAAATLQHSDSSNSSFPDLPARSSSQQKPTKGNTGSGKETKSTVKEHKGKSKQNDKTL 715
            :::            ||||:.|  |.....:..|.|          .:|.|::.           
Human   421 SSS------------SDSSSDS--DFEPSQNHSQGP----------LRSMVEDL----------- 450

  Fly   716 EKNTDKTEKPDKTPDPKVDKSEKSEKEDKKRNRRSSQSSNSGSGAGVTGAFIEPPVKASKKEQGK 780
                               :||:|:::|         ||:....||.|....:..:..|..|...
Human   451 -------------------QSEESDEDD---------SSSGEEAAGKTNPGRDSRLSFSDSESDN 487

  Fly   781 AAGEKSKSPSLRPPRETNSTGTGGGTPNAGAGFLAPPSSSPSNNHSAAVAASLNNNNNNNNNNTN 845
            :|  .|..||..||                     ||...|..|...             :...:
Human   488 SA--DSSLPSREPP---------------------PPQKPPPPNSKV-------------SGRRS 516

  Fly   846 SNSSHSPGEMTTPGQLQLPTEYLSELQELHHKIMTLQDNEELQHVVEMIAATGCYEITHKTFDFD 910
            ..|...|.::...|...  ..|..||.|||.::|.|::...||.:|.:|..||.:.:|:.|||||
Human   517 PESCSKPEKILKKGTYD--KAYTDELVELHRRLMALRERNVLQQIVNLIEETGHFNVTNTTFDFD 579

  Fly   911 LCKLDRGTVQRLQEFL 926
            |..||..||::||..|
Human   580 LFSLDETTVRKLQSCL 595

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
earNP_001262595.1 YEATS 27..107 CDD:281374 46/79 (58%)
MLLT1XP_011526323.1 YEATS 70..150 CDD:281374 46/79 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152547
Domainoid 1 1.000 117 1.000 Domainoid score I5919
eggNOG 1 0.900 - - E1_COG5033
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 188 1.000 Inparanoid score I3921
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003550
OrthoInspector 1 1.000 - - otm42157
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23195
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5409
SonicParanoid 1 1.000 - - X2426
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.880

Return to query results.
Submit another query.