DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ear and D12

DIOPT Version :9

Sequence 1:NP_001262595.1 Gene:ear / 44451 FlyBaseID:FBgn0026441 Length:945 Species:Drosophila melanogaster
Sequence 2:NP_609228.2 Gene:D12 / 34172 FlyBaseID:FBgn0027490 Length:969 Species:Drosophila melanogaster


Alignment Length:321 Identity:74/321 - (23%)
Similarity:132/321 - (41%) Gaps:53/321 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KVQFEIGHTSKLRSKKTPH----PQAFTHDWEIYVQGVNKAD-ISAFVEKVVFVLHESFPKPKRV 63
            |..|.:|:|||...:.:..    ..|.|:.|.:||||.:..: :..:::||.|.||.|: :|..:
  Fly   248 KFNFVVGNTSKYIGEDSRENGTGGNALTYKWLVYVQGKDLPEPLEKYIKKVRFHLHPSY-RPNDI 311

  Fly    64 --VKEPPYAIQESGYAGFLLPVEIYFRNRDEPKRIVYQYDLVLQSTGPPQHHVEVKTHI-FEAPS 125
              |...|:.:...|:..|.:.::::|:...:.|.:...:.:||..|....|.:..:|.: ....:
  Fly   312 VDVHRSPFQLNRHGWGEFPMRIQLFFQEHLQQKPVQLMHTVVLDKTMCGLHTMGAETTVEIWLRA 376

  Fly   126 EEFRTKLMRGGGVPVFGAN--IGAGSLA--RTLSPSVGS--GE---------TAHSNEMSGVKAK 175
            ::..||...|...|.....  :.|..||  ..|.|||.:  ||         |.:..|:......
  Fly   377 KQAITKQKSGKPHPPHEQETAVPAPPLAAPNVLEPSVFAFPGESCKPRTISITQNKEELDDNLFA 441

  Fly   176 GVPGTISMNSDLNTGK-----------KHKSRSEDPGKSNAFSALFGPPITK-----TSVTAN-- 222
            |: ..|.::.|:...:           .:..|.:.|..|:       ||.|:     ..|||:  
  Fly   442 GI-NKIELSDDIEKIEPTVLVSEPLKLNYSPRKQPPTPSS-------PPRTQLRLNAAQVTASKP 498

  Fly   223 NMAQVPVSKHSPEAKSAAVGGKGVFHEGRE--KASKDRD-KSSGGDKPREKDKKDRHGRDK 280
            ::..:||:..||..:|.....:..|...:.  .||..|. |.|..|:|..|...:.|.:.|
  Fly   499 SVVYLPVNGRSPRQESLPERQRQEFSPVKHYPPASPQRAWKESSSDRPPIKPVPNGHHQGK 559

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
earNP_001262595.1 YEATS 27..107 CDD:281374 21/82 (26%)
D12NP_609228.2 YEATS 275..357 CDD:281374 21/82 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457060
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5033
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482359at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23195
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.