DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ear and Gas41

DIOPT Version :9

Sequence 1:NP_001262595.1 Gene:ear / 44451 FlyBaseID:FBgn0026441 Length:945 Species:Drosophila melanogaster
Sequence 2:NP_609086.1 Gene:Gas41 / 33973 FlyBaseID:FBgn0031873 Length:227 Species:Drosophila melanogaster


Alignment Length:208 Identity:48/208 - (23%)
Similarity:86/208 - (41%) Gaps:53/208 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GHTSKLRSKKTPHPQAFTHDWEIYVQGVNKADISAFVEKVVFVLHESFPKPKRVVKEPPYAIQES 74
            |:.::...||. .....||.|::|::.....|:|.:|:||.|.||||:..|.|:|.:|||.|.|:
  Fly    24 GNIARSFGKKR-EEDGHTHQWKVYLKPYFNEDMSIYVKKVHFKLHESYANPNRIVVKPPYEITET 87

  Fly    75 GYAGFLLPVEIYFRNRDEPKRIVYQYDLVLQSTGP-------------------PQHHVEVKTHI 120
            |:..|.:.::|||  .|:.:|.|..|.::.....|                   .:.:.|:   :
  Fly    88 GWGEFEVIIKIYF--NDQSERPVTCYHILKLFQSPVVDGELSSSTTMDTKKGLVSESYEEI---V 147

  Fly   121 FEAPSEEFRTKLMRGGGVPVFGANIGAGSLARTLSPSVGSGETAHSNEMSGVKAKGVPGTISMNS 185
            |:.|::..:..|:                    ||....:|...|..:....|.|.:...:::  
  Fly   148 FQEPTQILQHYLL--------------------LSEQSANGLLTHDTDFEEKKTKTLDNIVNV-- 190

  Fly   186 DLNTGKKHKSRSE 198
                  |.|.:.|
  Fly   191 ------KQKVKGE 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
earNP_001262595.1 YEATS 27..107 CDD:281374 31/79 (39%)
Gas41NP_609086.1 YEATS 40..119 CDD:281374 31/80 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457059
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5033
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482359at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23195
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.