DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ear and CG2652

DIOPT Version :9

Sequence 1:NP_001262595.1 Gene:ear / 44451 FlyBaseID:FBgn0026441 Length:945 Species:Drosophila melanogaster
Sequence 2:NP_570015.1 Gene:CG2652 / 31250 FlyBaseID:FBgn0025838 Length:235 Species:Drosophila melanogaster


Alignment Length:275 Identity:52/275 - (18%)
Similarity:73/275 - (26%) Gaps:126/275 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PQAFTHDWEIYVQ-GVNKADISAFVEKVVFVLHESFPKPKRVVKEPPYAIQESGYAGFLLPVEIY 86
            |......|.:|:: |.:..|:|.||.:|.|.:....|....|....|:.|.|             
  Fly    53 PYMLEPTWGVYLRPGRDGGDLSRFVRRVTFKMSPRLPLRLHVADSAPFEIGE------------- 104

  Fly    87 FRNRDEPKRIVYQYDLVLQSTGPPQHHVEVKTHIFEAPSEEFRTKLMRGG--GV----------- 138
                            ||.|..|.:..|:.......|.|..||.:::|.|  |:           
  Fly   105 ----------------VLGSDFPVEVQVQYMDARMSATSYIFRPRVVREGHAGICEEMLDKMIFV 153

  Fly   139 ---PVFGANIGAGSLARTLSPSVGSGETAHSNEMSGVKAKGVPGTISMNSDLNTGKKHKSRSEDP 200
               |:...|     |...|.||                |.|.||                     
  Fly   154 NPSPMMRQN-----LTPVLVPS----------------ANGAPG--------------------- 176

  Fly   201 GKSNAFSALFGPPITKTSVTANNMAQVPVSKHSPEAKSAAVGGKGVFHEGREKASKDRDKSSGGD 265
                          .:||      .|..:....||...             |:..:|||:...||
  Fly   177 --------------DRTS------PQFAMESAMPETPG-------------ERKEQDRDREQVGD 208

  Fly   266 -----KPREKDKKDR 275
                 :|..|..|.|
  Fly   209 VARPSQPPAKQPKKR 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
earNP_001262595.1 YEATS 27..107 CDD:281374 16/80 (20%)
CG2652NP_570015.1 YEATS 26..>120 CDD:303059 20/95 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5033
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.